CAT# | C06007 |
M.W/Mr. | 3399.9 |
Sequence | CGNLSTCMLGTYTQDLNKFHTFPQTSIGVGAP-NH2 |
Length | 32 | Modifications | disulfide |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
C06021 | (Des-Cys1,cyclo(Ser2-Asu7))-Calcitonin (eel) | Inquiry | ||
C06023 | Biotinyl-Calcitonin (salmon I) | Inquiry | ||
C06010 | Calcitonin (salmon I) | Inquiry | ||
C06022 | Biotinyl-(Cys1,Lys(biotinyl)18)-Calcitonin (human) | Inquiry | ||
C06003 | Calcitonin C-Terminal Flanking Peptide (human) | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Tetracosactide (also known as Tetracosactide) is a synthetic peptide that is identical to the 24-amino acid segm ...
P11 (HSDVHK) is a novel peptide ligand containing a PDZ-binding motif (Ser-Asp-Val) with high affinity to integr ...
Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...
Trifluoroacetyl tripeptide-2 (TFA-T2) is an innovative peptide compound that has garnered significant attention in dermatolog ...
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...