β-Endorphin, equine

Tetracosactide is a synthetic peptide, which corresponds to the first 24 amino acids of the naturally occurring hormone ACTH (adrenocorticotropic hormone). It stimulates the adrenal cortex to produce corticosteroids, mineralocorticoids, and, to a lesser extent, androgens.

Online Inquiry

CAT#R1796
Explanationβ-Endorphin, equine is an endogenous opioid peptide with analgesic properties.
M.F/FormulaC154H248N42O44S
M.W/Mr.3423.94
SequenceOne Letter Code: YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ
Three Letter Code: Tyr-Gly-Gly-Phe-Met-Ser-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln
AppearanceWhite or off-white lyophilized powder
Purity≥98% (HPLC)
Activitybeta-Endorphin, equine is 1.6 times more potent than the human hormone in the mouse tail-flick assay [1].
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Contact Us

Address:

Tel: |

Email:

Copyright © 2022 Creative Peptides. All rights reserved.