CAT# | P15012 |
Sequence | AGECTPGQTKKQDCNTCTCTPTGIWGCTRKACRTTREAEEPAIV |
Length | 44 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
P15015 | serine protease inhibitor pi-4A | Inquiry | ||
P15018 | serine protease inhibitor pi-4Cp | Inquiry | ||
P15002 | PI2 | Inquiry | ||
P15004 | protease inhibitor PI-7 | Inquiry | ||
P15005 | protease inhibitor PI-8 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Camstatin is a similar PEP-19 analogue with enhanced calmodulin binding and antagonism. It is a functional 25- ...
Corticotropin-releasing factor (CRF) is a 41 amino acid peptide that is an important hormone in the hypothalamic ...
Muramyl dipeptide (MDP) is the smallest structural unit with immune activity in the skeleton of bacille calmette ...
APETx2, a 42 amino-acid peptide toxin isolated from sea anemone Anthopleura elegantissima, is a kind of acid-s ...
Galanin-(2–13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide (M871) is a novel peptide antagonist selectively recognizing ...