CAT# | P15012 |
Sequence | AGECTPGQTKKQDCNTCTCTPTGIWGCTRKACRTTREAEEPAIV |
Length | 44 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
P15016 | serine protease inhibitor pi-4B | Inquiry | ||
P15011 | protease inhibitor PI-9 | Inquiry | ||
P15003 | protease inhibitor PI-6 | Inquiry | ||
P15007 | protease inhibitor SGPI-5Bt | Inquiry | ||
P15018 | serine protease inhibitor pi-4Cp | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...
The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...
Caprooyl tetrapeptide-3, an anti-wrinkle peptide, a reaction product of caproic acid and tetrapeptide-3, compris ...
Palmitoyl Tripeptide-38, named MATRIXYL synthe'6 and Volulip, a cosmetic peptide or double-oxidized lipopeptide, ...