Amylin (IAPP), feline

Amylin (IAPP), feline, a 37-amino acid polypeptide. Amylin (IAPP) is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP) is a regulatory peptide, which inhibits insulin and glucagon secretion.

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1188
M.F/Formula	C₁₆₅H₂₇₀N₅₂O₅₄S₂
M.W/Mr.	3910.45
Sequence	One Letter Code: KCNTATCATQRLANFLIRSSNNLGAILSPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7) three Letter Code: Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Ile-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Ala-Ile-Leu-Ser-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge: Cys2-Cys7)

CAT#	Product Name	Inquiry
R1506	Mas7	Inquiry
R1890	Novexatin (NP213)	Inquiry
R0904	ZIP, Biotinylated	Inquiry
R1728	Transdermal Peptide	Inquiry
R1252	Brain Natriuretic Peptide (BNP) (1-32), rat TFA	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.