- Home
- COVID-19
- Services
- Products
- Research Areas
- Company
- Resources
- Ordering
Amylin (IAPP), feline, a 37-amino acid polypeptide. Amylin (IAPP) is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP) is a regulatory peptide, which inhibits insulin and glucagon secretion.
| CAT# | R1188 |
| M.F/Formula | C₁₆₅H₂₇₀N₅₂O₅₄S₂ |
| M.W/Mr. | 3910.45 |
| Sequence | One Letter Code: KCNTATCATQRLANFLIRSSNNLGAILSPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7) three Letter Code: Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Ile-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Ala-Ile-Leu-Ser-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge: Cys2-Cys7) |
| CAT# | Product Name | M.W | Molecular Formula | Inquiry |
|---|---|---|---|---|
| R1523 | Myelin Basic Protein MBP | Inquiry | ||
| R1470 | Kisspeptin-10 Trifluoroacetate | Inquiry | ||
| R1862 | β-CGRP, human | Inquiry | ||
| R1720 | TIP 39, Tuberoinfundibular Neuropeptide | Inquiry | ||
| R1582 | OVA Peptide (257-264) TFA | Inquiry |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
