Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 4131.6 |
Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG |
Length | 38 |
2. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
4. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.