β-Endorphin rat

β-Endorphin is an endogenous opioid peptide that acts as an agonist at μ-opioid receptors (μORs) and exhibits immunomodulatory, neuromodulatory, antidepressant, and antinociceptive/analgesic activities. In vivo, β-endorphin increases levels of B-cells and production of antibodies as well as secretion of IL-4 and proliferation of splenocytes, shifting the immune response toward Th2-specific mediators.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1885

CAS No:77367-63-6

Synonyms/Alias:β-Lipotropin (61-91), rat; Proopiomelanocortin; POMC.

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C157H254N42O44S
M.W/Mr.
3466.02
Sequence
One Letter Code: YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ
Three Letter Code: Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Val-His-Lys-Lys-Gly-Gln
Appearance
Whithe powder
Purity
≥97% (HPLC)

β-Endorphin rat is a naturally occurring endogenous opioid peptide derived from the precursor protein proopiomelanocortin (POMC) in rat species. As a member of the endorphin family, it plays a critical role in modulating pain perception, stress response, and neuroendocrine signaling within the central nervous system. Its sequence and structure are highly conserved among mammals, making it a valuable model for comparative studies in neurobiology and peptide signaling. Researchers utilize β-Endorphin rat to investigate the fundamental mechanisms underlying opioid receptor activation, neurotransmitter regulation, and the physiological consequences of endogenous peptide release. Its biochemical properties and defined activity profile make it an indispensable tool in peptide research, particularly in the context of neuropeptide function, receptor pharmacology, and behavioral neuroscience.

Receptor binding studies: β-Endorphin peptides are widely employed to characterize the binding affinity and selectivity of endogenous opioids for different opioid receptor subtypes, including mu, delta, and kappa receptors. By utilizing the rat-specific sequence, researchers can assess species-dependent variations in receptor interaction, elucidate structure-activity relationships, and compare the pharmacological properties of β-endorphin analogs. These investigations are crucial for advancing the understanding of opioid receptor dynamics and contribute to the rational design of new peptide ligands for research purposes.

Signal transduction research: The application of β-Endorphin rat in cellular and molecular assays enables the detailed exploration of downstream signaling pathways triggered by opioid receptor activation. It serves as a reference compound in studies examining G-protein coupled receptor (GPCR) signaling, second messenger cascades, and the modulation of ion channel activity. By tracking changes in intracellular signaling events following peptide exposure, scientists can dissect the molecular mechanisms governing neuronal excitability, synaptic transmission, and neurochemical homeostasis.

Neuropeptide release modeling: Investigators utilize β-endorphin peptides to model the endogenous release and regulation of neuropeptides under various physiological and experimental conditions. In vitro and ex vivo systems benefit from the controlled application of the peptide to study its effects on neurotransmitter secretion, neuronal circuit function, and feedback regulation within the hypothalamic-pituitary-adrenal (HPA) axis. These models provide insights into the dynamic interplay between stress, neuropeptide signaling, and adaptive responses in the central nervous system.

Behavioral neuroscience research: The rat β-endorphin peptide is instrumental in behavioral assays designed to probe the neurochemical basis of pain modulation, reward processing, and emotional regulation. Through targeted administration in animal models, researchers can analyze the peptide's impact on nociceptive thresholds, stress-coping behaviors, and motivational states. These studies inform the broader understanding of endogenous opioid systems in mediating complex behaviors and adaptive responses to environmental stimuli.

Peptide structure-function analysis: The defined sequence and biochemical properties of β-Endorphin rat make it suitable for advanced structure-function studies. Researchers employ the peptide in spectroscopic, crystallographic, and computational analyses to determine conformational dynamics, receptor interaction motifs, and critical residues responsible for biological activity. Such investigations facilitate the rational design of peptide analogs, support the development of receptor-selective ligands, and enhance knowledge of the relationship between peptide structure and function in endogenous opioid systems.

Long-term Storage Conditions
Soluble in water.
Shipping Condition
RT, or blue ice upon request.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOCustom Conjugation ServicePeptide Analysis ServicescGMP Peptide ServicePeptide Nucleic Acids SynthesisPeptide Modification ServicesEpitope Mapping ServicesPeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers