β-Endorphin rat

β-Endorphin is an endogenous opioid peptide that acts as an agonist at μ-opioid receptors (μORs) and exhibits immunomodulatory, neuromodulatory, antidepressant, and antinociceptive/analgesic activities. In vivo, β-endorphin increases levels of B-cells and production of antibodies as well as secretion of IL-4 and proliferation of splenocytes, shifting the immune response toward Th2-specific mediators.

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1885
CAS	77367-63-6
Synonyms/Alias	β-Lipotropin (61-91), rat; Proopiomelanocortin; POMC.
M.F/Formula	C157H254N42O44S
M.W/Mr.	3466.02
Sequence	One Letter Code: YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ Three Letter Code: Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Val-His-Lys-Lys-Gly-Gln
Appearance	Whithe powder
Purity	≥97% (HPLC)

CAT#	Product Name	Inquiry
R1570	Nuclear pore complex protein Nup98 315-360	Inquiry
R2009	Felypressin	Inquiry
R1563	Nociceptin (1-13), amide	Inquiry
R1538	Neuromedin U, rat	Inquiry
HB00025	Fitc-ASTD-FMK	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Storage	Store at -20°C
Solubility	Soluble in water.
Shipping Condition	RT, or blue ice upon request.