CAT# | R1872 |
CAS | 96827-07-5 |
Synonyms/Alias | HGH (Human Growth Hormone) |
M.F/Formula | C240H358N62O67S |
M.W/Mr. | 5215.93 |
Sequence | One Letter Code: FPTIPLSALFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYS Three Letter Code: H-Phe-Pro-Thr-Ile-Pro-Leu-Ser-Arg-Leu-Phe-Asp-Asn-Ala-Met-Leu-Arg-Ala-His-Arg-Leu-His-Gln-Leu-Ala-Phe-Asp-Thr-Tyr-Gln-Glu-Phe-Glu-Glu-Ala-Tyr-Ile-Pro-Lys-Glu-Gln-Lys-Tyr-Ser-OH |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Obtustatin isolated from the venom of the Vipera lebetina obtusa viper is a highly potent integrin α1β1 inhibito ...
Palmitoyl Tripeptide-38, named MATRIXYL synthe'6 and Volulip, a cosmetic peptide or double-oxidized lipopeptide, ...
Developed by the German company Hoechst Marion Roussel and derived from genetic modification of hirudin, lepirud ...
Timonacic's chemical name, L-Syrosin-4, is a new anti-tumor drug that converts cancer cells into normal cells. E ...
ICI 174,864 is an opioid peptide, belonging to subclasses of opioid receptors. Its chemical structure is N, N-di ...