HGH(1-43)

HGH(1-43) is the N-terminal fragment of human growth hormone containing structural motifs important for initial folding and receptor priming. The sequence presents helical regions and flexible loops suitable for studying hormone maturation. Researchers use it to examine conformational transitions and proteolytic processing. Its length supports detailed structural and biophysical analyses.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
HGH(1-43)(CAS 96827-07-5)

CAT No: R1872

CAS No:96827-07-5

Synonyms/Alias:CHEMBL38204;FH108896;96827-07-5;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C11H13BrN2O5
M.W/Mr.
333.13
Sequence
One Letter Code: FPTIPLSALFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYS
Three Letter Code: H-Phe-Pro-Thr-Ile-Pro-Leu-Ser-Arg-Leu-Phe-Asp-Asn-Ala-Met-Leu-Arg-Ala-His-Arg-Leu-His-Gln-Leu-Ala-Phe-Asp-Thr-Tyr-Gln-Glu-Phe-Glu-Glu-Ala-Tyr-Ile-Pro-Lys-Glu-Gln-Lys-Tyr-Ser-OH

HGH(1-43), also known as Human Growth Hormone fragment 1-43, is a synthetic peptide corresponding to the N-terminal 43 amino acids of the full-length human growth hormone protein. As a distinct peptide fragment, it retains specific structural motifs and functional domains relevant to growth hormone biology, making it a valuable tool for dissecting the molecular mechanisms underlying growth hormone action. Researchers utilize this fragment to explore the sequence-specific roles of HGH in cellular signaling, receptor binding, and metabolic regulation. Its defined structure and biochemical properties position it as a versatile reagent for peptide-based investigations in endocrinology, molecular biology, and protein engineering.

Receptor interaction studies: One of the primary research applications of HGH(1-43) involves elucidating the interaction between growth hormone and its cellular receptors. By isolating the N-terminal fragment, investigators can pinpoint the amino acid residues critical for receptor recognition and binding affinity. This facilitates detailed mapping of ligand-receptor interfaces and supports the rational design of analogs or antagonists for probing growth hormone signaling pathways. Such studies are instrumental in advancing the understanding of growth hormone's structure-function relationships at the molecular level.

Peptide structure-function analysis: The fragment serves as an essential model for examining the structural determinants of growth hormone activity. Through biophysical and biochemical assays, researchers can assess how specific truncations or modifications within the N-terminal region influence peptide folding, stability, and biological activity. These insights are crucial for peptide engineering efforts aimed at optimizing bioactive sequences or developing novel peptide-based probes for functional studies.

Biochemical assay development: HGH(1-43) is frequently employed as a standard or control in the development and validation of immunoassays, such as ELISA or Western blot protocols, targeting growth hormone or its fragments. Its defined sequence enables precise calibration of assay sensitivity and specificity, supporting the quantification of endogenous or exogenous growth hormone derivatives in research samples. The use of this fragment enhances the reliability of analytical methods in endocrinology and protein chemistry laboratories.

Cellular signaling investigations: The peptide is utilized in cell-based assays to study the downstream effects of growth hormone receptor activation. By applying the fragment to cultured cells, researchers can monitor specific signaling cascades, gene expression changes, or metabolic responses attributable to the N-terminal portion of the hormone. This approach aids in dissecting the contribution of discrete growth hormone domains to cellular outcomes, providing a clearer picture of the hormone's multifaceted roles.

Peptide synthesis and modification research: HGH(1-43) is also valuable as a substrate or template in peptide synthesis studies. Its well-characterized sequence allows for systematic modification, such as site-directed mutagenesis or chemical labeling, to investigate structure-activity relationships or to create functionalized peptides for advanced biochemical applications. These capabilities support innovation in peptide chemistry, enabling the generation of tailored molecules for mechanistic studies, biomarker discovery, or assay development.

Source#
Synthetic
Shipping Condition
+20°C (International: -20°C)
InChI
InChI=1S/C11H13BrN2O5/c1-8(15)19-5-4-18-7-14-6-9(2-3-12)10(16)13-11(14)17/h2-3,6H,4-5,7H2,1H3,(H,13,16,17)/b3-2+
InChI Key
YBDRIKJGEROSDJ-NSCUHMNNSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicesPeptide CDMOPeptide Modification ServicescGMP Peptide ServiceCustom Conjugation ServicePeptide Nucleic Acids SynthesisEpitope Mapping ServicesPeptide Analysis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers