1. Home
  2. Products
  3. Therapeutic Peptides
  4. Peptide Inhibitors
  5. HGH(1-43)

HGH(1-43)

HGH(1-43) is the N-terminal fragment of human growth hormone containing structural motifs important for initial folding and receptor priming. The sequence presents helical regions and flexible loops suitable for studying hormone maturation. Researchers use it to examine conformational transitions and proteolytic processing. Its length supports detailed structural and biophysical analyses.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
HGH(1-43)(CAS 96827-07-5)

CAT No: R1872

CAS No:96827-07-5

Synonyms/Alias:CHEMBL38204;FH108896;96827-07-5;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C11H13BrN2O5
M.W/Mr.
333.13
Sequence
One Letter Code: FPTIPLSALFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYS
Three Letter Code: H-Phe-Pro-Thr-Ile-Pro-Leu-Ser-Arg-Leu-Phe-Asp-Asn-Ala-Met-Leu-Arg-Ala-His-Arg-Leu-His-Gln-Leu-Ala-Phe-Asp-Thr-Tyr-Gln-Glu-Phe-Glu-Glu-Ala-Tyr-Ile-Pro-Lys-Glu-Gln-Lys-Tyr-Ser-OH
Source#
Synthetic
Shipping Condition
+20°C (International: -20°C)
InChI
InChI=1S/C11H13BrN2O5/c1-8(15)19-5-4-18-7-14-6-9(2-3-12)10(16)13-11(14)17/h2-3,6H,4-5,7H2,1H3,(H,13,16,17)/b3-2+
InChI Key
YBDRIKJGEROSDJ-NSCUHMNNSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesEpitope Mapping ServicesCustom Conjugation ServicePeptide Modification ServicesPeptide Synthesis ServicesPeptide CDMOcGMP Peptide ServicePeptide Nucleic Acids Synthesis
Hot Products
Fertirelin Acetate

Fertirelin Acetate is a synthetic peptide that promotes ovulation and fertility. Purchase Fertirelin research peptide for breeding and hormonal studies.

Read More Read More
Icatibant

Icatibant is a potent bradykinin B2 receptor antagonist peptide for inflammation and allergy research. Buy Icatibant peptide from a reliable peptide supplier to support biomedical studies.

Read More Read More
Atosiban

Atosiban is a peptide oxytocin receptor antagonist that helps prevent preterm labor. Buy Atosiban peptide for reproductive and uterine contractility research.

Read More Read More
Carbetocin

Carbetocin is a synthetic oxytocin analog that promotes uterine contraction and postpartum recovery. Buy Carbetocin peptide powder from a professional supplier for reproductive research.

Read More Read More
Aviptadil Acetate

Aviptadil Acetate is a vasoactive intestinal peptide for lung and immune research. Purchase this synthetic peptide for studies on pulmonary health and inflammation.

Read More Read More
Terlipressin

Terlipressin is a synthetic vasopressin analog that supports vascular and renal research. Purchase Terlipressin peptide from a verified supplier for liver and hemodynamic studies.

Read More Read More
GLP-1 (7-37) Acetate

GLP-1 (7-37) Acetate is a synthetic peptide for appetite and insulin regulation. Order GLP-1 peptide powder from a trusted supplier for metabolic research.

Read More Read More
Thymopentin Acetate

Thymopentin Acetate peptide enhances immune modulation and T-cell function. Purchase Thymopentin research peptide online for immunotherapy and cell biology research.

Read More Read More
DOTA-cyclo(RGDfK) acetate

DOTA-cyclo(RGDfK) Acetate is a radiolabeled peptide for tumor imaging and targeting research. Purchase this high-purity peptide for oncology and diagnostic studies.

Read More Read More
Terlipressin Acetate

Terlipressin Acetate is a synthetic vasopressin analog peptide used for vascular and liver research. Buy Terlipressin peptide powder online from a trusted peptide supplier for professional studies.

Read More Read More
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers