Human growth hormone-releasing factor

Human growth hormone-releasing factor stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Human growth hormone-releasing factor(CAS 83930-13-6)

CAT No: R1435

CAS No:83930-13-6

Synonyms/Alias:Somatorelin;83930-13-6;Somatorelin [INN];UNII-4UR7N9Z9MM;4UR7N9Z9MM;DTXSID40232828;Somatorelin (INN);SOMATORELIN (MART.);SOMATORELIN [MART.];Somatoliberin (human);Human growth hormone-releasing factor;somatorelina;somatoreline;somatorelinum;Somatocrinin;Somatoliberin;Esfarase;Ghrh ferring;Somatoliberin, human;Ghrh(1-44) amide;Ghrh(1-44)nh2;GRF (human) acetate salt;SOMATOLIBERIN [MI];SOMATORELIN [WHO-DD];Grf 1-44;GRF (1-44), human?;DTXCID70155319;V04CD05;DA-67692;FG109065;PD151144;Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2;GROWTH HORMONE RELEASING HORMONE, 1-44 HUMAN AMIDE;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C215H358N72O66S
M.W/Mr.
5040
Sequence
One Letter Code:YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Three Letter Code:H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2

Human growth hormone-releasing factor is a synthetic peptide that mimics the endogenous hypothalamic hormone responsible for stimulating the secretion of growth hormone from the anterior pituitary gland. As a key regulator of the growth hormone axis, it plays a pivotal role in the modulation of growth, metabolism, and cellular regeneration. Its structure and activity have made it a valuable tool in biochemical research, particularly in studies focused on neuroendocrine signaling, peptide hormone interactions, and downstream metabolic pathways. The precise sequence and bioactivity of this peptide enable researchers to dissect the mechanisms underlying hormone release and to develop advanced models of pituitary function.

Peptide hormone research: Human growth hormone-releasing factor serves as a critical reagent in the investigation of peptide hormone signaling pathways. By providing a reliable and controllable means to stimulate growth hormone secretion in vitro, it allows for detailed analysis of receptor-ligand dynamics, signal transduction mechanisms, and the regulatory feedback loops that govern endocrine function. Researchers utilize this peptide to characterize the specificity and affinity of growth hormone-releasing hormone receptors, as well as to elucidate the molecular determinants of hormone-receptor interactions.

Endocrine system modeling: The peptide is widely used in the development of experimental models that simulate hypothalamic-pituitary axis function. By incorporating it into cell-based or organotypic culture systems, scientists can replicate physiologically relevant hormone release events and study the temporal dynamics of growth hormone secretion. Such models are instrumental in advancing understanding of neuroendocrine regulation, pituitary cell differentiation, and the integration of hormonal signals that control growth and metabolism.

Peptide synthesis and structure-activity relationship studies: As a well-characterized peptide, growth hormone-releasing factor is frequently employed in structure-activity relationship (SAR) analyses. Researchers synthesize analogs and truncated variants to probe the essential residues required for biological activity, receptor binding, and signal initiation. These studies contribute to the rational design of novel peptide agonists or antagonists, facilitate the mapping of active domains, and support the optimization of peptide-based research tools.

Assay development and validation: The peptide is an indispensable standard for the development and calibration of bioassays aimed at quantifying growth hormone release. By serving as a positive control in in vitro and ex vivo assay systems, it enables the accurate measurement of pituitary responsiveness and the assessment of test compounds that may modulate the growth hormone axis. Its use in assay validation is critical for ensuring reproducibility, sensitivity, and specificity in hormone research.

Neuropharmacological investigations: Researchers utilize growth hormone-releasing factor in studies exploring the central regulation of metabolism, stress responses, and neuroendocrine integration. By administering the peptide to neuronal or hypothalamic tissue preparations, scientists can investigate the downstream effects of growth hormone signaling on gene expression, synaptic plasticity, and metabolic adaptation. These applications are central to unraveling the complex interplay between the nervous and endocrine systems and provide a foundation for advancing basic neuroendocrinology research.

InChI
InChI=1S/C215H358N72O66S/c1-24-106(15)166(285-174(318)112(21)251-193(337)145(91-163(309)310)270-173(317)109(18)249-175(319)119(218)86-115-49-53-117(293)54-50-115)208(352)278-142(87-114-39-27-26-28-40-114)200(344)287-168(113(22)292)209(353)279-144(90-157(225)301)199(343)283-150(99-291)204(348)274-141(88-116-51-55-118(294)56-52-116)197(341)261-126(47-37-78-243-214(235)236)181(325)260-122(42-30-32-73-217)192(336)284-165(105(13)14)206(350)277-137(82-101(5)6)178(322)247-95-160(304)253-129(58-65-152(220)296)185(329)272-140(85-104(11)12)196(340)282-147(96-288)202(346)252-111(20)172(316)256-124(45-35-76-241-212(231)232)180(324)259-121(41-29-31-72-216)184(328)271-139(84-103(9)10)195(339)273-138(83-102(7)8)194(338)266-133(61-68-155(223)299)190(334)276-146(92-164(311)312)201(345)286-167(107(16)25-2)207(351)268-135(71-80-354-23)191(335)281-148(97-289)203(347)262-127(48-38-79-244-215(237)238)182(326)264-131(59-66-153(221)297)187(331)263-128(57-64-151(219)295)177(321)246-94-159(303)254-130(62-69-161(305)306)186(330)280-149(98-290)205(349)275-143(89-156(224)300)198(342)267-132(60-67-154(222)298)188(332)265-134(63-70-162(307)308)189(333)258-120(43-33-74-239-210(227)228)176(320)245-93-158(302)248-108(17)170(314)255-123(44-34-75-240-211(229)230)179(323)250-110(19)171(315)257-125(46-36-77-242-213(233)234)183(327)269-136(169(226)313)81-100(3)4/h26-28,39-40,49-56,100-113,119-150,165-168,288-294H,24-25,29-38,41-48,57-99,216-218H2,1-23H3,(H2,219,295)(H2,220,296)(H2,221,297)(H2,222,298)(H2,223,299)(H2,224,300)(H2,225,301)(H2,226,313)(H,245,320)(H,246,321)(H,247,322)(H,248,302)(H,249,319)(H,250,323)(H,251,337)(H,252,346)(H,253,304)(H,254,303)(H,255,314)(H,256,316)(H,257,315)(H,258,333)(H,259,324)(H,260,325)(H,261,341)(H,262,347)(H,263,331)(H,264,326)(H,265,332)(H,266,338)(H,267,342)(H,268,351)(H,269,327)(H,270,317)(H,271,328)(H,272,329)(H,273,339)(H,274,348)(H,275,349)(H,276,334)(H,277,350)(H,278,352)(H,279,353)(H,280,330)(H,281,335)(H,282,340)(H,283,343)(H,284,336)(H,285,318)(H,286,345)(H,287,344)(H,305,306)(H,307,308)(H,309,310)(H,311,312)(H4,227,228,239)(H4,229,230,240)(H4,231,232,241)(H4,233,234,242)(H4,235,236,243)(H4,237,238,244)/t106-,107-,108-,109-,110-,111-,112-,113+,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-,165-,166-,167-,168-/m0/s1
InChI Key
JAHCMOSSKRAPEL-IBFVROBCSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServicePeptide Modification ServicesPeptide CDMOPeptide Nucleic Acids SynthesisPeptide Synthesis ServicesCustom Conjugation ServicePeptide Analysis ServicesEpitope Mapping Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers