Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C155H251N49O40S |
M.W/Mr. | 3473.07 |
Sequence | HADAIFTSSYRRILGQLYARKLLHEIMNR-NH2 |
Length | 29 |
3. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
4. High fat diet and GLP-1 drugs induce pancreatic injury in mice
5. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.