CAT# | G09012 |
M.F/Formula | C240H358N62O67S1 |
M.W/Mr. | 5216.2 |
Sequence | FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYS |
Length | 43 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
G09011 | GRF (ovine, caprine) | Inquiry | ||
G09014 | Growth Hormone (6-13), human | Inquiry | ||
G09008 | Growth Hormone Releasing Factor, GRF (1 - 44), amide, human | Inquiry | ||
G09004 | Growth Hormone Pro-Releasing Factor, human | Inquiry | ||
G09015 | (beta-Asp3)-GRF (human) | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...
Myristoyl hexapeptide-4, a stabilized peptide, is a synthetic peptide containing lysine, threonine and serine re ...
PAC-113, as well as a new type of Trp-rich peptide, is a 12 amino-acid fragment of the saliva protein histatin 5 ...
Ornithoctonus huwena, Chinese tarantula, is one of the most venomous spiders in China, and its venom can kill in ...
The β-amyloid precursor protein (APP) is connected to Alzheimer's disease by both biochemistry and genetics. As ...