Growth Hormone (1-43), human

Growth Hormone (1-43), human, is an N-terminal fragment used to study α-helical organization and early folding events in GH. Its sequence supports mapping of hydrophobic clusters and turn transitions. Researchers evaluate motif exposure to understand receptor-binding frameworks. The molecule contributes to structural endocrinology.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: G09012

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C240H358N62O67S1
M.W/Mr.
5216.2
Sequence
FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYS
Length
43

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicescGMP Peptide ServicePeptide CDMOPeptide Nucleic Acids SynthesisEpitope Mapping ServicesCustom Conjugation ServicePeptide Modification ServicesPeptide Analysis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers