Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 4543.1 |
Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGA-NH2 |
Length | 40 |
1. Emu oil in combination with other active ingredients for treating skin imperfections
2. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
5. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
Required fields are marked with *
×Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.