S961 is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively.
Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C211H297N55O71S2 |
M.W/Mr. | 4804.13 |
Sequence | One Letter Code: GSLDESFYDWFERQLGGGSGGSSLEEEWAQIQCEVWGRGCPSY Three Letter Code: Gly-Ser-Leu-Asp-Glu-Ser-Phe-Tyr-Asp-Trp-Phe-Glu-Arg-Gln-Leu-Gly-Gly-Gly-Ser-Gly-Gly-Ser-Ser-Leu-Glu-Glu-Glu-Trp-Ala-Gln-Ile-Gln-Cys-Glu-Val-Trp-Gly-Arg-Gly-Cys-Pro-Ser-Tyr (Disulfide bridge: Cys33-Cys40) |
Appearance | White to off-white lyophilized solid |
Purity | >97% (by HPLC) |
Activity | In vitro, S961 also shows high-affinity to Rat IR and Pig IR with IC50s of 0.056 nM and 0.084 nM in PEG-assay, respectively. |
Long-term Storage Conditions | Soluble in H2O |
Shipping Condition | Room temperature |
1. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
2. The spatiotemporal control of signalling and trafficking of the GLP-1R
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.