S961

S961 is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1841

CAS No:1083433-49-1

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C211H297N55O71S2
M.W/Mr.
4804.13
Sequence
One Letter Code: GSLDESFYDWFERQLGGGSGGSSLEEEWAQIQCEVWGRGCPSY
Three Letter Code: Gly-Ser-Leu-Asp-Glu-Ser-Phe-Tyr-Asp-Trp-Phe-Glu-Arg-Gln-Leu-Gly-Gly-Gly-Ser-Gly-Gly-Ser-Ser-Leu-Glu-Glu-Glu-Trp-Ala-Gln-Ile-Gln-Cys-Glu-Val-Trp-Gly-Arg-Gly-Cys-Pro-Ser-Tyr (Disulfide bridge: Cys33-Cys40)
Appearance
White to off-white lyophilized solid
Purity
>97% (by HPLC)
Activity
In vitro, S961 also shows high-affinity to Rat IR and Pig IR with IC50s of 0.056 nM and 0.084 nM in PEG-assay, respectively.

S961 is a synthetic peptide antagonist specifically designed to target and inhibit the insulin receptor. As a high-affinity, selective peptide, S961 has gained significant attention in biochemical and metabolic research for its exceptional ability to modulate insulin signaling pathways. Its unique structure confers potent antagonistic activity, making it a valuable molecular tool for dissecting insulin receptor-mediated processes, investigating metabolic disorders, and validating hypotheses in cellular signaling studies. Researchers utilize S961 to probe the physiological and molecular consequences of insulin resistance, contributing to a deeper understanding of glucose homeostasis and metabolic regulation.

Insulin signaling research: S961 serves as a critical reagent for investigating the intricacies of insulin receptor function and downstream signaling pathways. By selectively blocking receptor activation, it enables researchers to delineate the specific roles of insulin in cellular glucose uptake, gene expression, and metabolic regulation. Using this peptide antagonist, scientists can dissect the contributions of insulin signaling to various cellular processes, facilitating the identification of novel regulatory nodes and potential drug targets within the insulin pathway.

Metabolic disorder modeling: In metabolic research, S961 is frequently employed to create experimental models of insulin resistance in vitro and in vivo. By antagonizing the insulin receptor, it induces a state of impaired insulin signaling, which closely mimics the pathophysiology observed in metabolic syndromes such as type 2 diabetes and obesity. This approach allows for controlled studies of compensatory mechanisms, disease progression, and the evaluation of metabolic biomarkers under insulin-resistant conditions, providing valuable insights into the etiology and progression of metabolic diseases.

Pharmacological validation: The peptide is widely used as a benchmark antagonist in the pharmacological evaluation of insulin receptor agonists, sensitizers, or novel modulators. Its well-characterized mechanism of action provides a robust tool for validating the specificity and efficacy of candidate compounds targeting the insulin signaling axis. By comparing the effects of new agents in the presence or absence of S961, researchers can confirm on-target activity and assess potential off-target interactions, streamlining the drug discovery process for metabolic disorders.

Receptor-ligand interaction studies: S961 is instrumental in elucidating the structural and functional dynamics of insulin receptor-ligand interactions. Its high affinity and selectivity allow for precise competitive binding assays, enabling the mapping of receptor binding sites and the quantification of ligand-receptor affinities. These studies are essential for advancing the understanding of receptor activation mechanisms, guiding the rational design of novel peptide or small molecule modulators, and informing structure-based drug development efforts.

Peptide antagonist mechanism exploration: The use of S961 extends to fundamental investigations of antagonist mechanisms in peptide-receptor systems. By providing a model of competitive inhibition at the peptide-receptor interface, it supports broader research into the principles governing receptor antagonism, conformational changes, and downstream biological outcomes. Insights gained from these studies not only deepen knowledge of insulin receptor biology but also contribute to the conceptual framework for designing next-generation peptide therapeutics and research tools targeting other receptor systems.

Long-term Storage Conditions
Soluble in H2O
Shipping Condition
Room temperature

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Epitope Mapping ServicesPeptide Analysis ServicesPeptide Nucleic Acids SynthesisPeptide Modification ServicesPeptide Synthesis ServicescGMP Peptide ServicePeptide CDMOCustom Conjugation Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers