S961

S961 is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1841

CAS No:1083433-49-1

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C211H297N55O71S2
M.W/Mr.
4804.13
Sequence
One Letter Code: GSLDESFYDWFERQLGGGSGGSSLEEEWAQIQCEVWGRGCPSY
Three Letter Code: Gly-Ser-Leu-Asp-Glu-Ser-Phe-Tyr-Asp-Trp-Phe-Glu-Arg-Gln-Leu-Gly-Gly-Gly-Ser-Gly-Gly-Ser-Ser-Leu-Glu-Glu-Glu-Trp-Ala-Gln-Ile-Gln-Cys-Glu-Val-Trp-Gly-Arg-Gly-Cys-Pro-Ser-Tyr (Disulfide bridge: Cys33-Cys40)
Appearance
White to off-white lyophilized solid
Purity
>97% (by HPLC)
Activity
In vitro, S961 also shows high-affinity to Rat IR and Pig IR with IC50s of 0.056 nM and 0.084 nM in PEG-assay, respectively.
Long-term Storage Conditions
Soluble in H2O
Shipping Condition
Room temperature

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesCustom Conjugation ServicecGMP Peptide ServicePeptide Modification ServicesEpitope Mapping ServicesPeptide Synthesis ServicesPeptide Nucleic Acids SynthesisPeptide CDMO
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers