Nesiritide

Nesiritide is an agonist of natriuretic peptide receptors (NPRs), with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1530

CAS No:124584-08-3

Synonyms/Alias:Brain Natriuretic Peptide-32 human; BNP-32

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₁₄₃H₂₄₄N₅₀O₄₂S₄
M.W/Mr.
3464.04
Sequence
One Letter Code: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: Cys10-Cys26)
three Letter Code: Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His (Disulfide bridge: Cys10-Cys26)
Activity
Agonist
Biological Activity
Nesiritide, a recombinant human B-type natriuretic peptide, is the first in a new drug class for the treatment of decompensated heart failure.

Nesiritide is a recombinant peptide corresponding to human B-type natriuretic peptide (BNP), a member of the natriuretic peptide family with well-characterized roles in cardiovascular homeostasis. As a synthetic peptide analog, it exhibits the distinctive structural and functional properties of endogenous BNP, including its capacity to modulate vascular tone, natriuresis, and diuresis through cyclic GMP-mediated signaling pathways. Nesiritide's biochemical relevance stems from its ability to engage natriuretic peptide receptors, making it an important molecular tool for investigating peptide signaling, receptor pharmacology, and cardiovascular peptide biology. Its availability in research-grade form enables detailed studies into the mechanisms underlying natriuretic peptide function, biomarker discovery, and peptide-based assay development.

Peptide receptor pharmacology: Nesiritide serves as a valuable research tool for studying the binding dynamics and signaling mechanisms of natriuretic peptide receptors, particularly NPR-A (guanylate cyclase-A). By providing a consistent and well-characterized ligand, it allows researchers to dissect receptor-ligand interactions, downstream cyclic GMP generation, and the modulation of cellular responses in various cell types. Such studies are fundamental for mapping receptor specificity, characterizing receptor mutants, and elucidating the molecular determinants of peptide recognition.

Signal transduction research: The peptide's ability to robustly activate guanylate cyclase-linked signaling cascades makes it instrumental for analyzing the downstream effects of cyclic GMP in cardiovascular and renal cell models. Investigators employ nesiritide to probe the regulation of ion transport, endothelial function, and smooth muscle relaxation, thereby advancing understanding of how natriuretic peptides orchestrate complex physiological processes at the cellular and tissue levels.

Peptide assay development: As a structurally defined BNP analog, nesiritide is routinely utilized in the development and validation of immunoassays, bioassays, and receptor-binding assays targeting natriuretic peptides. Its stability and reproducibility facilitate the calibration of analytical platforms, the assessment of assay specificity, and the benchmarking of novel detection technologies. These applications are critical for both academic research and the development of diagnostic tools centered on natriuretic peptide measurement.

Biomarker research: Nesiritide provides a reference standard for studies focused on BNP-related biomarkers in cardiovascular and renal research. By serving as a positive control or comparative analyte, it supports the evaluation of assay sensitivity, the establishment of detection thresholds, and the exploration of BNP's role as a surrogate marker in experimental models of cardiac stress, fluid overload, or renal dysfunction. Such work is essential for refining biomarker-based research strategies and improving the reliability of quantitative peptide analysis.

Peptide structure-function analysis: The recombinant nature and sequence fidelity of nesiritide enable detailed investigations into the structure-activity relationships of natriuretic peptides. Researchers leverage it to perform mutagenesis, truncation, and analog synthesis studies, aiming to delineate the specific amino acid residues and structural motifs responsible for receptor activation, signal transduction, and biological activity. These insights contribute to the broader understanding of peptide hormone evolution, receptor selectivity, and the design of next-generation peptide probes for biochemical and pharmacological research.

Source#
Synthetic

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesPeptide Modification ServicesEpitope Mapping ServicesPeptide CDMOPeptide Nucleic Acids SynthesiscGMP Peptide ServicePeptide Synthesis ServicesCustom Conjugation Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers