Nesiritide is an agonist of natriuretic peptide receptors (NPRs), with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively.
CAT No: R1530
CAS No: 124584-08-3
Synonyms/Alias: Brain Natriuretic Peptide-32 human; BNP-32
Quick InquiryCustom Peptide SynthesisPeptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C₁₄₃H₂₄₄N₅₀O₄₂S₄ |
M.W/Mr. | 3464.04 |
Sequence | One Letter Code: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: Cys10-Cys26) three Letter Code: Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His (Disulfide bridge: Cys10-Cys26) |
Activity | Agonist |
Biological Activity | Nesiritide, a recombinant human B-type natriuretic peptide, is the first in a new drug class for the treatment of decompensated heart failure. |
Source# | Synthetic |
1. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
2. High fat diet and GLP-1 drugs induce pancreatic injury in mice
3. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
4. Cationic cell-penetrating peptides are potent furin inhibitors
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.