APETx2 is selective and reversible blocker of acid-sensing ion channel 3 (ASIC3) (ic50 values are 63 and 175 nm for homomeric rat and human asic3 channels). It also inhibits nav1.8 and nav1.2 channels (ic50 values are 55 and 114 nm respectively). It shows analgesic effect on acid induced and inflammatory pain.
CAT# | R0883 |
CAS | 713544-47-9 |
Background | APETx2, a peptide toxin effector of ASIC3, has been purified from an extract of the sea anemone Anthopleura elegantissima. APETx2 is a 42-amino-acid peptide cross-linked by three disulfide bridges. Its three-dimensional structure, as determined by conventional two-dimensional 1 H-NMR, consists of a compact disulfidebonded core composed of a four-stranded b-sheet. It belongs to the disulfide-rich all-b structural family encompassing peptide toxins commonly found in animal venoms. >> Read More |
M.F/Formula | C196H280N54O61S6 |
M.W/Mr. | 4561.06 |
Sequence | GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bridge between 4-37, 6-30, 20-38) |
Labeling Target | Acid-sensing ion channel 3 (ASIC3) |
Purity | >98% |
Activity | Blocker |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Peptides are the ideal drug molecules because of their high affinity, high selectivity, low toxicity, and easy synthesis. Sci ...
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...
Glucagon-like peptide-1 (GLP-1) and glucose-depended insulinotropic polypeptide (GIP) are the two peptides that have been con ...
Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...
ICI 174,864 is an opioid peptide, belonging to subclasses of opioid receptors. Its chemical structure is N, N-di ...