CAT# | A13207 |
M.W/Mr. | 3335.9 |
Sequence | EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
Length | 32 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
A13038 | Beta-Amyloid (15-25) | Inquiry | ||
A13205 | [Met]-beta-Amyloid (1-28), mouse, rat | Inquiry | ||
A13008 | Beta-Amyloid (25-35) | Inquiry | ||
A13291 | [Ala20]-beta-Amyloid (1-42) | Inquiry | ||
A13172 | Beta-Amyloid (17-42) . HCl | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×1. Implications of ligand-receptor binding kinetics on GLP-1R signalling
2. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
3. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
4. Cationic cell-penetrating peptides are potent furin inhibitors
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Acetyl Glutamyl Heptapeptide-3, named SNAP-8, Acetyl GlutaMyl Octapeptide-3, Acetyl Octapeptide-1, Acetyl Octape ...
TC 14012 is a serum-stable derivative of the peptidomimetic T140, which is a cyclic peptide with the structure o ...
C 21 is a kind of selective protein arginine methyltransferase 1 (PRMT1) inhibitor (IC50 = 1.8 μM). And it exhib ...
Discovery and Structure Calcitonin, also called thyrocalcitonin, a protein hormone synthesized and secreted in humans and oth ...
Guangxitoxin 1E is a KV2.1 and KV2.2 specific channel blocker (IC50 values are 1-3 nM). The experimental results ...