β-Amyloid (1-42), (1-40), (1-46) and Fragments

Beta-Amyloid (3-42)

Price Inquiry
CAT#
A13266
Sequence
EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
M.W/Mr.
4327.9
Length
40

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.