Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C192H291N53O58S1 |
M.W/Mr. | 4301.84 |
Sequence | DAEFRHDSGYEVHHQKLAFFAEDVGSNKGAIIGLMVGGVV |
Length | 40 |
1. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
2. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
3. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.