β-Amyloid 1-40

β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease.

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1778
Chemical Structure
CAS	131438-79-4
M.F/Formula	C194H295N53O58S1
M.W/Mr.	4329.82
Sequence	One Letter Code: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV Three Letter Code: Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
Biological Activity	Peptide found in plaques in the brains of patients with Alzheimer's disease. Shown to have both neurotrophic and neurotoxic effects.

CAT#	Product Name	Inquiry
R1536	Neuromedin B	Inquiry
R1774	β-Amyloid 12-20	Inquiry
R1460	JAG-1, scrambled	Inquiry
PI-004	AZD5582	Inquiry
R1314	Cyclic somatostatin	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Storage	Desiccate at -20°C
Solubility	Soluble to 1 mg/ml in water
Shipping Condition	Room temperature in continental US; may vary elsewhere.