β-Amyloid 1-40

β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
β-Amyloid 1-40(CAS 131438-79-4)

CAT No: R1778

CAS No:131438-79-4

Synonyms/Alias:beta-Amyloid 1-40;131438-79-4;Abeta40;Human beta-amyloid peptide (1-40);Abeta40 [MI];Abeta(1-40);beta-Amyloid protein(1-40);UNII-13539D6GO8;Human beta-amyloid peptide-(1-40);Amyloid beta peptide(1-40) (synthetic);13539D6GO8;Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val;beta-Amyloid (1-40);Beta-Amyloid(1-40);beta-amyloid 40;DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV;Beta-amyloid protein 40;CHEBI:64646;Amyloid beta-Peptide 1-40 TFA;EX-A7736;AKOS024456454;FA110057;(Asn7)-Amyloid b-Protein (1-40) trifluoroacetate salt;H-Asp-Ala-Glu-Phe-Arg-His-Asn-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe- Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-G ly-Leu-Met-Val-Gly-Gly-Val-Val-OH; H-DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C194H295N53O58S
M.W/Mr.
4330
Sequence
One Letter Code:DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Three Letter Code:H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
Biological Activity
Peptide found in plaques in the brains of patients with Alzheimer's disease. Shown to have both neurotrophic and neurotoxic effects.

β-Amyloid 1-40 is a synthetic peptide corresponding to the first 40 amino acids of the human β-amyloid protein, a key fragment derived from the amyloid precursor protein (APP) through sequential proteolytic processing. This peptide is widely recognized for its central role in neurodegenerative research, particularly in the study of amyloid plaque formation and the molecular mechanisms underlying Alzheimer's disease. Its defined sequence and aggregation properties make it a valuable biochemical tool for elucidating the structural and functional aspects of amyloidogenesis, protein misfolding, and peptide aggregation phenomena. As a research-grade peptide, β-Amyloid 1-40 is indispensable for laboratories investigating the biophysical, cellular, and molecular events associated with amyloid pathology and related neurobiological processes.

Aggregation studies: β-Amyloid 1-40 is extensively used in aggregation assays to investigate the kinetics and thermodynamics of amyloid fibril formation. Researchers employ this peptide to model the nucleation and elongation phases of amyloid aggregation in vitro, enabling the characterization of fibrillar and oligomeric intermediates. These studies provide foundational insights into the physicochemical factors that drive peptide self-assembly, including solvent conditions, concentration effects, and sequence-specific interactions, which are critical for understanding the molecular basis of amyloid-related disorders.

Neurotoxicity research: The peptide serves as a model agent for probing the cytotoxic effects of amyloid aggregates on neuronal and glial cells. By exposing cultured neural cells to β-amyloid 1-40, investigators can assess cellular responses such as oxidative stress, apoptosis, and synaptic dysfunction. These experiments help delineate the pathways by which amyloid species compromise cell viability and contribute to neurodegeneration, offering a platform for the identification and evaluation of protective strategies or modulators of toxicity.

Screening of aggregation inhibitors: The defined aggregation behavior of β-amyloid 1-40 makes it an ideal substrate for high-throughput screening of small molecules, peptides, or antibodies that modulate amyloid formation. Researchers utilize this peptide in biochemical and biophysical assays to quantify the efficacy of candidate inhibitors in preventing fibril growth or destabilizing existing aggregates. These screening campaigns are pivotal for the discovery and mechanistic validation of compounds with potential to mitigate amyloid pathology at the molecular level.

Structural biology investigations: β-Amyloid 1-40 is frequently employed in advanced structural studies, including nuclear magnetic resonance (NMR) spectroscopy, circular dichroism (CD), and cryo-electron microscopy (cryo-EM). By analyzing the conformational transitions and secondary structure elements of this peptide under various experimental conditions, scientists gain detailed knowledge of the molecular architecture of amyloid fibrils and oligomers. Such insights are essential for the rational design of structure-based probes and inhibitors targeting amyloidogenic peptides.

Development of detection assays: The peptide is also utilized as a standard or calibrator in the development and validation of analytical assays for amyloid quantification, such as enzyme-linked immunosorbent assays (ELISA), fluorescence-based detection, and mass spectrometry protocols. Incorporating β-amyloid 1-40 into assay development ensures specificity and sensitivity in the measurement of amyloid species in complex biological samples, supporting biomarker discovery and the refinement of diagnostic methodologies for neurodegenerative research.

Long-term Storage Conditions
Soluble to 1 mg/ml in water
Shipping Condition
Room temperature in continental US; may vary elsewhere.
InChI
InChI=1S/C194H295N53O58S/c1-25-102(19)158(188(299)211-87-143(256)218-124(67-94(3)4)174(285)228-123(62-66-306-24)172(283)241-152(96(7)8)186(297)209-83-140(253)206-84-145(258)240-154(98(11)12)191(302)245-157(101(17)18)193(304)305)247-192(303)159(103(20)26-2)246-162(273)104(21)215-141(254)85-207-164(275)116(47-36-38-63-195)223-181(292)133(77-139(199)252)234-185(296)137(90-249)220-144(257)88-210-187(298)153(97(9)10)242-184(295)135(79-151(269)270)235-170(281)121(56-60-147(261)262)222-161(272)106(23)217-173(284)127(69-107-41-30-27-31-42-107)231-177(288)129(71-109-45-34-29-35-46-109)237-189(300)156(100(15)16)244-183(294)125(68-95(5)6)229-166(277)117(48-37-39-64-196)224-168(279)119(54-58-138(198)251)226-178(289)130(73-111-80-202-91-212-111)233-180(291)132(75-113-82-204-93-214-113)238-190(301)155(99(13)14)243-171(282)122(57-61-148(263)264)227-175(286)126(72-110-50-52-114(250)53-51-110)219-142(255)86-208-165(276)136(89-248)239-182(293)134(78-150(267)268)236-179(290)131(74-112-81-203-92-213-112)232-167(278)118(49-40-65-205-194(200)201)225-176(287)128(70-108-43-32-28-33-44-108)230-169(280)120(55-59-146(259)260)221-160(271)105(22)216-163(274)115(197)76-149(265)266/h27-35,41-46,50-53,80-82,91-106,115-137,152-159,248-250H,25-26,36-40,47-49,54-79,83-90,195-197H2,1-24H3,(H2,198,251)(H2,199,252)(H,202,212)(H,203,213)(H,204,214)(H,206,253)(H,207,275)(H,208,276)(H,209,297)(H,210,298)(H,211,299)(H,215,254)(H,216,274)(H,217,284)(H,218,256)(H,219,255)(H,220,257)(H,221,271)(H,222,272)(H,223,292)(H,224,279)(H,225,287)(H,226,289)(H,227,286)(H,228,285)(H,229,277)(H,230,280)(H,231,288)(H,232,278)(H,233,291)(H,234,296)(H,235,281)(H,236,290)(H,237,300)(H,238,301)(H,239,293)(H,240,258)(H,241,283)(H,242,295)(H,243,282)(H,244,294)(H,245,302)(H,246,273)(H,247,303)(H,259,260)(H,261,262)(H,263,264)(H,265,266)(H,267,268)(H,269,270)(H,304,305)(H4,200,201,205)/t102-,103-,104-,105-,106-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,152-,153-,154-,155-,156-,157-,158-,159-/m0/s1
InChI Key
FEWOUVRMGWFWIH-ILZZQXMPSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServicePeptide Modification ServicescGMP Peptide ServicePeptide Analysis ServicesPeptide CDMOPeptide Synthesis ServicesEpitope Mapping ServicesPeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers