Calcitonin Gene Related Peptide (CGRP) is a highly potent vasodialator and can function in the transmission of pain
CAT No: R1862
CAS No: 101462-82-2
Synonyms/Alias: Human β-CGRP; CGRP-II (Human); Calcitonin Gene Related Peptide II, human
Quick InquiryCustom Peptide SynthesisPeptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C162H267N51O48S3 |
M.W/Mr. | 3793.41 |
Sequence | One Letter Code: [C2C7]ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF Three Letter Code: [Cys2-Cys7] Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 |
Application | Neuropeptide |
Appearance | White or off-white lyophilized powder |
Source# | Synthetic |
Long-term Storage Conditions | 10 mM in H2O |
Shipping Condition | Wet ice in continental US; may vary elsewhere |
3. The spatiotemporal control of signalling and trafficking of the GLP-1R
5. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.
USA
Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA
Tel: 1-631-624-4882
Fax: 1-631-614-7828
Email: info@creative-peptides.com
Germany
Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main
Email: info@creative-peptides.com