β-CGRP, human

Tetracosactide is a synthetic peptide, which corresponds to the first 24 amino acids of the naturally occurring hormone ACTH (adrenocorticotropic hormone). It stimulates the adrenal cortex to produce corticosteroids, mineralocorticoids, and, to a lesser extent, androgens.

Online Inquiry

CAT#R1862
ExplanationCalcitonin Gene Related Peptide (CGRP) is a highly potent vasodialator and can function in the transmission of pain
Synonyms/AliasHuman β-CGRP; CGRP-II (Human); Calcitonin Gene Related Peptide II, human
M.F/FormulaC162H267N51O48S3
M.W/Mr.3793.41
SequenceOne Letter Code: [C2C7]ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF
Three Letter Code: [Cys2-Cys7] Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2
ApplicationNeuropeptide
AppearanceWhite or off-white lyophilized powder
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Contact Us

Address:

Tel: |

Email:

Copyright © 2022 Creative Peptides. All rights reserved.