β-CGRP, human

Calcitonin Gene Related Peptide (CGRP) is a highly potent vasodialator and can function in the transmission of pain

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1862
CAS	101462-82-2
Synonyms/Alias	Human β-CGRP; CGRP-II (Human); Calcitonin Gene Related Peptide II, human
M.F/Formula	C162H267N51O48S3
M.W/Mr.	3793.41
Sequence	One Letter Code: [C2C7]ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF Three Letter Code: [Cys2-Cys7] Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2
Application	Neuropeptide
Appearance	White or off-white lyophilized powder

CAT#	Product Name	Inquiry
R1710	Tau protein (592-597), Human TFA	Inquiry
R1242	Boc-Gly-Gly-Phe-Gly-OH TFA	Inquiry
R1265	Calcitonin, eel TFA	Inquiry
R1527	N-Acetyl-α-Endorphin	Inquiry
R0863	R8-T198wt	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Source#	Synthetic
Storage	Store the unopened product at -20 to -70 °C. Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Do not use past expiration date.
Solubility	10 mM in H2O
Shipping Condition	Wet ice in continental US; may vary elsewhere