β-CGRP, human

Calcitonin Gene Related Peptide (CGRP) is a highly potent vasodialator and can function in the transmission of pain

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1862

CAS No:101462-82-2

Synonyms/Alias:Human β-CGRP; CGRP-II (Human); Calcitonin Gene Related Peptide II, human

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C162H267N51O48S3
M.W/Mr.
3793.41
Sequence
One Letter Code: [C2C7]ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF
Three Letter Code: [Cys2-Cys7] Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2
Application
Neuropeptide
Appearance
White or off-white lyophilized powder

β-CGRP, human, is a synthetic peptide corresponding to the human beta isoform of calcitonin gene-related peptide (CGRP). As a 37-amino acid neuropeptide, it is recognized for its potent vasodilatory properties and its role as a key mediator in neurogenic inflammation, pain transmission, and cardiovascular regulation. The molecule is of significant interest in neurobiology and vascular research, providing a valuable tool for elucidating the physiological and pathological functions of CGRP in human systems. Its high sequence fidelity to the native human peptide makes it particularly relevant for in vitro and ex vivo studies aiming to model human-specific biochemical processes.

Neurobiology research: β-CGRP, human, serves as a critical reagent for investigating the molecular mechanisms underlying sensory neurotransmission and neurogenic inflammation. By enabling controlled stimulation of CGRP receptors in neuronal cell cultures or tissue preparations, it allows researchers to dissect the signaling pathways involved in pain perception, synaptic modulation, and neuroimmune interactions. The peptide's defined sequence ensures reproducibility in experiments exploring the modulation of neuronal excitability and the release of secondary messengers in sensory pathways.

Vascular biology studies: The peptide is widely utilized in vascular pharmacology to study vasodilation and endothelial function. Its ability to induce potent relaxation of vascular smooth muscle makes it a preferred standard for assays evaluating the responsiveness of blood vessels to neuropeptidergic stimuli. Researchers employ it in organ bath experiments, perfusion models, and cellular assays to quantify receptor-mediated responses, providing insights into vascular tone regulation, endothelial signaling, and potential mechanisms underlying migraine and other vascular pathologies.

Receptor pharmacology and ligand-binding assays: β-CGRP, human, is instrumental in characterizing the pharmacodynamics of CGRP receptors. It is used in radioligand binding assays, competition studies, and functional receptor assays to assess ligand affinity, receptor density, and downstream signaling events. These applications are fundamental for profiling the selectivity of novel small molecules, antagonists, or monoclonal antibodies targeting CGRP pathways, which are of growing interest in both basic and translational neuropharmacology.

Peptide structure-function analysis: The defined sequence and synthetic accessibility of the human β-CGRP peptide make it a valuable template for structure-activity relationship (SAR) studies. By employing site-directed mutagenesis or chemical modifications, researchers can probe the contribution of specific amino acid residues to receptor binding, stability, and bioactivity. Such studies advance understanding of peptide-receptor interactions and inform the rational design of next-generation CGRP analogs or modulators.

Analytical standard and assay development: β-CGRP, human, is commonly used as a reference standard in analytical techniques such as HPLC, mass spectrometry, and immunoassays. Its well-characterized properties support the development and validation of quantitative assays for endogenous CGRP detection in biological samples. These assays are essential for monitoring peptide release, metabolism, and clearance in experimental models, thereby facilitating accurate measurement of neuropeptide dynamics in diverse research settings.

Source#
Synthetic
Long-term Storage Conditions
10 mM in H2O
Shipping Condition
Wet ice in continental US; may vary elsewhere

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesPeptide CDMOEpitope Mapping ServicesCustom Conjugation ServicecGMP Peptide ServicePeptide Synthesis ServicesPeptide Analysis ServicesPeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers