- Home
- COVID-19
- Services
- Products
- Research Areas
- Company
- Resources
- Ordering
Tetracosactide is a synthetic peptide, which corresponds to the first 24 amino acids of the naturally occurring hormone ACTH (adrenocorticotropic hormone). It stimulates the adrenal cortex to produce corticosteroids, mineralocorticoids, and, to a lesser extent, androgens.
| CAT# | R1862 |
| Explanation | Calcitonin Gene Related Peptide (CGRP) is a highly potent vasodialator and can function in the transmission of pain |
| Synonyms/Alias | Human β-CGRP; CGRP-II (Human); Calcitonin Gene Related Peptide II, human |
| M.F/Formula | C162H267N51O48S3 |
| M.W/Mr. | 3793.41 |
| Sequence | One Letter Code: [C2C7]ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF Three Letter Code: [Cys2-Cys7] Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 |
| Application | Neuropeptide |
| Appearance | White or off-white lyophilized powder |
| Source# | Synthetic | Long-term Storage Conditions | 10 mM in H2O | Shipping Condition | Wet ice in continental US; may vary elsewhere |
| CAT# | Product Name | M.W | Molecular Formula | Inquiry |
|---|---|---|---|---|
| R1629 | Proadrenomedullin (45-92), human | Inquiry | ||
| R0984 | Huwentoxin IV | Inquiry | ||
| R1508 | Mastoparan | Inquiry | ||
| R1842 | Crotamine | Inquiry | ||
| R1214 | Arg-Gly-Glu-Ser | Inquiry |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
