GLP-1(7-37)

CAT#	R1382
Chemical Structure
CAS	106612-94-6
Synonyms/Alias	Proglucagon (78-108) (human, bovine, guinea pig, mouse, rat), Insulinotropin (human, bovine, guinea pig, mouse, rat), Glucagon-Like Peptide 1 (7-37) (human, bovine, guinea pig, mouse, rat), Preproglucagon (98-128) (human, bovine, guinea pig, mouse, rat)
M.F/Formula	C151H228N40O47
M.W/Mr.	3355.67
Sequence	One Letter Code: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG Three Letter Code: His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly
Biological Activity	Endogenous GLP-1 receptor ligand; bioactive and truncated form of GLP-1; insulinotropic hormone.

Storage	Desiccate at -20°C
Solubility	H2O : 30 mg/mL (8.94 mM; Need ultrasonic and warming)
Shipping Condition	Room temperature in continental US; may vary elsewhere.

CAT#	Product Name	M.W	Molecular Formula	Inquiry
R1646	Psalmotoxin 1			Inquiry
HB00035	Biotin-LEVD-FMK			Inquiry
R1812	Lanreotide			Inquiry
R1318	Cyclosporin A-Derivative 2			Inquiry
R1866	Nemifitide (diTFA)			Inquiry

1. Olfactory receptor based piezoelectric biosensors for detection of alcohols related to food safety applications

2. Emu oil in combination with other active ingredients for treating skin imperfections

3. Uncarboxylated osteocalcin decreases insulin-stimulated glucose uptake without affecting insulin signaling and regulators of mitochondrial biogenesis in myotubes

4. Myotropic activity and immunolocalization of selected neuropeptides of the burying beetle Nicrophorus vespilloides (Coleoptera: Silphidae)

5. P-selectin and Complement’s Role in a Neonatal Model of Germinal Matrix Hemorrhage-Induced Secondary Injury