GLP-1(7-37)

GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
GLP-1(7-37)(CAS 106612-94-6)

CAT No: R1382

CAS No:106612-94-6

Synonyms/Alias:GLP-1(7-37) Acetate;106612-94-6;1450806-98-0;Glucagon-like Peptide-1 (7-37);CID 16133830;GLP-1 (7-37);Glp-1(7-37)acetate;GLP-1 (7-37) peptide;DTXSID50147676;AKOS025142102;AC-8923;DA-53584;DA-73755;FG110440;TS-10360;F92802;GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat) acetate salt;H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly- Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH; H -HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C151H228N40O47
M.W/Mr.
3355.7
Sequence
One Letter Code:HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Three Letter Code:H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH
Biological Activity
Endogenous GLP-1 receptor ligand; bioactive and truncated form of GLP-1; insulinotropic hormone.

GLP-1(7-37), also known as glucagon-like peptide-1 (7-37), is a biologically active peptide fragment derived from the proglucagon precursor. As a member of the incretin hormone family, it plays a central role in modulating glucose metabolism and insulin secretion through its interaction with the GLP-1 receptor. The molecule's potent effects on pancreatic beta cells and its involvement in gut-brain axis signaling have made it a focal point in metabolic and endocrinological research. Its ability to influence multiple physiological pathways underscores its importance as a research tool for elucidating complex regulatory mechanisms in energy homeostasis and nutrient sensing.

Peptide signaling studies: GLP-1(7-37) is widely utilized in studies investigating peptide-mediated signal transduction, specifically those related to the activation of the GLP-1 receptor. By serving as a highly selective agonist, it enables researchers to dissect the downstream effects of GLP-1 receptor engagement, including modulation of cyclic AMP levels, activation of protein kinase A, and the regulation of intracellular calcium dynamics. These studies are critical for mapping the molecular cascades underlying insulinotropic responses and for understanding the broader physiological roles of peptide hormones.

Metabolic pathway research: The peptide is frequently employed as a reference standard in experiments focused on glucose-stimulated insulin secretion and metabolic regulation. Its well-characterized biological activity provides a reliable tool for probing the mechanisms by which incretin hormones modulate pancreatic function, hepatic glucose output, and peripheral tissue glucose uptake. By incorporating GLP-1(7-37) into metabolic assays, investigators can quantitatively assess the contributions of incretin signaling to overall glucose homeostasis, facilitating the identification of novel targets within metabolic pathways.

Peptide-receptor interaction analysis: GLP-1(7-37) serves as a model ligand in the characterization of peptide-receptor binding dynamics and affinity studies. Its defined sequence and receptor specificity make it ideal for kinetic and structural analyses, including radioligand binding assays, surface plasmon resonance experiments, and computational docking studies. Through these approaches, researchers can elucidate the molecular determinants of receptor activation, ligand selectivity, and signal transduction efficiency, which are essential for guiding the rational design of receptor modulators.

Cellular signaling pathway elucidation: Researchers utilize GLP-1(7-37) to explore the downstream effects of incretin signaling in various cell types, including pancreatic islets, neuronal populations, and gastrointestinal tissues. By applying the peptide in vitro or ex vivo, scientists can monitor changes in gene expression, protein phosphorylation states, and cellular secretory responses. These investigations provide mechanistic insight into the cross-talk between metabolic, neural, and endocrine systems, expanding our understanding of the integrative physiology governed by peptide hormones.

Peptide analog development: The well-defined structure and biological activity profile of GLP-1(7-37) make it a valuable template for the design and synthesis of novel peptide analogs and mimetics. Researchers leverage its sequence to generate modified peptides with altered receptor affinity, enhanced stability, or tailored pharmacodynamic properties for experimental purposes. Such analogs are instrumental in structure-activity relationship studies, enabling the systematic evaluation of residue contributions to receptor binding and biological function, and supporting the advancement of next-generation peptide-based research tools.

Long-term Storage Conditions
H2O : 30 mg/mL (8.94 mM; Need ultrasonic and warming)
Shipping Condition
Room temperature in continental US; may vary elsewhere.
InChI
InChI=1S/C151H228N40O47/c1-17-77(10)121(148(236)169-81(14)127(215)177-105(60-87-63-160-92-36-25-24-35-90(87)92)138(226)179-101(56-74(4)5)139(227)188-119(75(6)7)146(234)176-94(37-26-28-52-152)130(218)161-65-111(199)170-93(39-30-54-159-151(156)157)129(217)164-68-118(210)211)190-140(228)103(57-84-31-20-18-21-32-84)180-135(223)99(47-51-116(206)207)175-134(222)95(38-27-29-53-153)172-125(213)79(12)166-124(212)78(11)168-133(221)98(44-48-110(155)198)171-112(200)66-162-132(220)97(46-50-115(204)205)174-136(224)100(55-73(2)3)178-137(225)102(59-86-40-42-89(197)43-41-86)181-143(231)107(69-192)184-145(233)109(71-194)185-147(235)120(76(8)9)189-142(230)106(62-117(208)209)182-144(232)108(70-193)186-150(238)123(83(16)196)191-141(229)104(58-85-33-22-19-23-34-85)183-149(237)122(82(15)195)187-113(201)67-163-131(219)96(45-49-114(202)203)173-126(214)80(13)167-128(216)91(154)61-88-64-158-72-165-88/h18-25,31-36,40-43,63-64,72-83,91,93-109,119-123,160,192-197H,17,26-30,37-39,44-62,65-71,152-154H2,1-16H3,(H2,155,198)(H,158,165)(H,161,218)(H,162,220)(H,163,219)(H,164,217)(H,166,212)(H,167,216)(H,168,221)(H,169,236)(H,170,199)(H,171,200)(H,172,213)(H,173,214)(H,174,224)(H,175,222)(H,176,234)(H,177,215)(H,178,225)(H,179,226)(H,180,223)(H,181,231)(H,182,232)(H,183,237)(H,184,233)(H,185,235)(H,186,238)(H,187,201)(H,188,227)(H,189,230)(H,190,228)(H,191,229)(H,202,203)(H,204,205)(H,206,207)(H,208,209)(H,210,211)(H4,156,157,159)/t77-,78-,79-,80-,81-,82+,83+,91-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,119-,120-,121-,122-,123-/m0/s1
InChI Key
GCYXWQUSHADNBF-AAEALURTSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServicePeptide Analysis ServicesCustom Conjugation ServiceEpitope Mapping ServicesPeptide Modification ServicesPeptide CDMOPeptide Synthesis ServicesPeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers