GLP-1(7-37)

GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion.

Online Inquiry

CAT#R1382
Chemical Structure
CAS106612-94-6
Synonyms/AliasProglucagon (78-108) (human, bovine, guinea pig, mouse, rat), Insulinotropin (human, bovine, guinea pig, mouse, rat), Glucagon-Like Peptide 1 (7-37) (human, bovine, guinea pig, mouse, rat), Preproglucagon (98-128) (human, bovine, guinea pig, mouse, rat)
M.F/FormulaC151H228N40O47
M.W/Mr.3355.67
SequenceOne Letter Code: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Three Letter Code: His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly
Biological ActivityEndogenous GLP-1 receptor ligand; bioactive and truncated form of GLP-1; insulinotropic hormone.
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Contact Us

Address:

Tel: |

Email:

Copyright © 2022 Creative Peptides. All rights reserved.