Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 4498.1 |
Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAPIGLMVGGVVIA |
Length | 42 |
1. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
2. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
3. Emu oil in combination with other active ingredients for treating skin imperfections
5. TMEM16F and dynamins control expansive plasma membrane reservoirs
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.