CAT# | P03038 |
M.F/Formula | C194H314N58O53S2 |
M.W/Mr. | 4371.12 |
Sequence | VSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG |
Length | 37 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
P03045 | pTH (29-32) (human) | Inquiry | ||
P03041 | Parathyroid Hormone (1-38), human | Inquiry | ||
P03003 | Parathyroid Hormone (70-84), human | Inquiry | ||
P03015 | Parathyroid Hormone (39-68), human | Inquiry | ||
P03039 | pTH (1-37) (human) | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Econazole, commonly used as sulfosalicylate and nitrate salt, is an imidazole broad-spectrum antifungal drug, wh ...
The peptide neuroprotectant Tat-NR2B9c, also known as NA-1, is a Tat peptide consisting of the nine C-terminal ...
Palmitoyl Tripeptide-1 is also called Part of Matrixyl 3000. Palmitoyl Oligopeptide and Pal-GHK are believed to be able to st ...
Trifluoroacetyl tripeptide-2 (TFA-T2) is an innovative peptide compound that has garnered significant attention in dermatolog ...
of Tripeptide-1 The tripeptide-1 (glycyl-L-histadyl-L-lysine or GHK) is primarily known as carrier peptides. It ...