Keywords Search Google Search Search

Beta-defensin 103A

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF3147
Sequence	GIINTLQKYYCRVRGGRCAVLTCLPKEEQIGKCSTRGRKCCRRKK
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF1104	Brevinin-1CPa	Inquiry
AF2457	TPA_exp: EP2E protein	Inquiry
AF1393	Soybean toxin 27 kDa chain	Inquiry
AF745	Ranacyclin-B-RN2	Inquiry
AF3037	Bacteriocin divergicin M35	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

A novel antiarrhythmic peptide–rotigaptide

Rotigaptide is a novel antiarrhythmic peptide that enhances gap junction (GJ) intercellular conductance between cardiomyocy ...

Application of ZIP to block the constitutive activity of PKMζ

Long-term potentiation (LTP) is a persistent synaptic enhancement which is thought to be a substrate for memory. ...

Gap 19: Specifically block Cx43 hemichannels inhibitor

Gap 19 is a nonapeptide derived from the cytoplasmic loop (CL) of Connexin-43 (Cx43). Cx43 is a predominant card ...

PAC-113: A clinically active antimicrobial peptide

PAC-113, as well as a new type of Trp-rich peptide, is a 12 amino-acid fragment of the saliva protein histatin 5 ...

A brief review of Octreotide

Octreotide, a long-acting structural derivative of somatostatins, is a synthetic peptide analog of somatostatin with the same ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Pan troglodytes
Length	45
SwissProt ID	Q95JD2