Brain Natriuretic Peptide, Human

Name: Brain Natriuretic Peptide, Human
Brand: Creative Peptides
SKU: 10-101-25
Availability: MadeToOrder

Brain natriuretic peptide, uretic peptide or Ventricular Natriuretic Peptide (still BNP), is a 32-amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes). BNP is named as such because it was originally identified in extracts of porcine brain, although in humans it is produced mainly in the cardiac ventricles.

Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

CAT No: 10-101-25

CAS No: 124584-08-3 (net)

Synonyms/Alias: Natriuretic Peptide, Brain; BNP-32; Natrecor; BNP; B-Type Natriuretic Peptide; BNP32; BNP 32; Nesiritide; Type-B Natriuretic Peptide

Quick Inquiry Custom Peptide Synthesis

Peptide Library Construction and Screening

Powerful screening tools in biological and chemical research

Specification Technical Data Publications Customer reviews and Q&A

M.F/Formula	C143H244N50O42S4
M.W/Mr.	3464.09
Sequence	SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH(Modifications: Disulfide bridge between 10 - 26)
Labeling Target	Atrial natriuretic peptide receptor
Application	Brain natriuretic peptide (BNP) decreases the systemic vascular resistance and central venous pressure as well as increases the natriuresis. Thus, the net effect of BNP and atrial natriuretic peptide (ANP) is a decrease in blood volume, which lowers systemic blood pressure and afterload, yielding an increase in cardiac output, partly due to a higher ejection fraction.
Areas of Interest	Cardiovascular Disease
Functions	Protein kinase activity

Source#	Synthetic
Solubility	−20°C
Organism	Human
BoilingPoint	N/A
References	Higher BNP concentrations early after first myocardial infarction are associated with adverse left ventricular remodelling characteristics. This may help explain why BNP is such a strong predictor of outcome after myocardial infarction. Crilley J G, Farrer M. Left ventricular remodelling and brain natriuretic peptide after first myocardial infarction[J]. Heart, 2001, 86(6): 638-642. Subtle cardiac abnormalities have been described in patients with cirrhosis. Natriuretic peptide hormones have been reported to be sensitive markers of early cardiac disease. We postulate that plasma levels of N-terminal pro-atrial natriuretic peptide and brain natriuretic peptide could be used as markers of cardiac dysfunction in cirrhosis. Florence W, Samuel S I U, Peter L I U, et al. Brain natriuretic peptide: is it a predictor of cardiomyopathy in cirrhosis?[J]. Clinical Science, 2001, 101(6): 621-628.
Melting Point	N/A

1. C-peptide and its C-terminal fragments improve erythrocyte deformability in type 1 diabetes patients

2. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function

3. Zeta-potential-changing nanoparticles conjugated with cell-penetrating peptides for enhanced transfection efficiency

4. Quantitative Analysis of Ligands Effects on Bioefficacy of Nanoemulsion encapsulating Depigmenting Active

5. TMEM16F and dynamins control expansive plasma membrane reservoirs

Write a review Ask a question

Featured Recommendations

Related Screening Libraries:

Peptide Drug Gene Construction and Expression Platform Peptide Screening Services High-throughput Screening Peptide Tools AI-based Peptide Drug Discovery and Structure Analysis Platform

Related Small Molecules:

Glatiramer acetate Sincalide Ammonium Salt Pentagastrin Cetrorelix Desirudin Vancomycin Leuprolide Acetate

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.

Featured Services

Alarelin acetate

Alarelin acetate is a synthetic LH-RH agonist, and stimulates the release of FSH and LH from the pituitary gland. It is known for its induction of ovulation and used to treat endmometriosis.

Inquiry
Fertirelin Acetate

Fertirelin acetate is a potent LHRH agonist. After a transient increase, continuous administration results in downregulation of LH and FSH levels followed by a suppression of ovarian and testicular steroid biosynthesis.

Inquiry
Teriparatide Acetate

Teriparatide(recombinant human parathyroid hormone) /PTH (1-34) (human) corresponds to the N-terminal part of human parathyroid hormone, a peptide consisting of 84 amino acids.

Inquiry
Atosiban

Atosiban is a nonapeptide, desamino-oxytocin analogue, and a competitive vasopressin/oxytocin receptor antagonist (VOTra). Atosiban is indicated to delay imminent pre-term birth in pregnant adult women. Atosiban is useful in improving the pregnancy outcome of in vitro fertilization-embryo transfer (IVF-ET) in patients with repeated implantation failure (RIF). The pregnancy rate improved from zero to 43.7%.

Inquiry
Somatostatin

Somatostatin is a tetradecapeptide which can suppress the growth hormone (GH) secretion and control the pituitary hormone secretion in human CNS.

Inquiry
Glucagon

Glucagon (Porcine glucagon) is a peptide hormone, produced by pancreatic α-cells. Glucagon stimulates gluconeogenesis. Glucagon decreases the activity of HNF-4. Glucagon increases HNF4α phosphorylation.

Inquiry
Thymopentin Acetate

Thymopentin, also known as TP-5, is a synthetic derivative of thymopoietin, a thymic hormone, and has immunoregulatory properties. Thymopentin interacts with T cells, reduces endocrine and behavioral responses to experimental stress. It is also found to increase the number of cells undergoing apoptosis in irradiated cells and selectively bind to apoptotic cells.

Inquiry
Aviptadil Acetate

Aviptadil, also known as vasoactive intestinal polypeptide (VIP), is a 28 amino acid neuropeptide that belongs to the glucagon-growth hormone-releasing factor secretion superfamily. Aviptadil acts as a potent systemic vasodilator and bronchodilator. It inhibits the proliferation of vascular and bronchial smooth muscle cells and decreases platelet aggregation. These biological effects are mediated by specific VIP receptors.

Inquiry
Argipressin

Vasopressin, also known as arginine vasopressin (AVP), antidiuretic hormone (ADH), or argipressin, is a neurohypophysial hormone found in most mammals. Its two primary functions are to retain water in the body and to constrict blood vessels.

Inquiry
DOTA-cyclo(RGDfK) acetate

Inquiry