Brain Natriuretic Peptide, Human

Brain natriuretic peptide, uretic peptide or Ventricular Natriuretic Peptide (still BNP), is a 32-amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes). BNP is named as such because it was originally identified in extracts of porcine brain, although in humans it is produced mainly in the cardiac ventricles.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: 10-101-25

CAS No:124584-08-3 (net)

Synonyms/Alias:Natriuretic Peptide, Brain; BNP-32; Natrecor; BNP; B-Type Natriuretic Peptide; BNP32; BNP 32; Nesiritide; Type-B Natriuretic Peptide

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C143H244N50O42S4
M.W/Mr.
3464.09
Sequence
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH(Modifications: Disulfide bridge between 10 - 26)
Labeling Target
Atrial natriuretic peptide receptor
Application
Brain natriuretic peptide (BNP) decreases the systemic vascular resistance and central venous pressure as well as increases the natriuresis. Thus, the net effect of BNP and atrial natriuretic peptide (ANP) is a decrease in blood volume, which lowers systemic blood pressure and afterload, yielding an increase in cardiac output, partly due to a higher ejection fraction.
Areas of Interest
Cardiovascular Disease
Functions
Protein kinase activity

Brain Natriuretic Peptide, Human is a synthetic or recombinant form of the naturally occurring peptide hormone primarily secreted by the cardiac ventricles in response to increased wall tension and stress. Characterized by its 32-amino acid structure, this peptide plays a central role in cardiovascular homeostasis, mediating natriuretic, diuretic, and vasodilatory effects through specific receptor interactions. Its biochemical properties, including stability in solution and compatibility with a variety of assay platforms, make it highly suitable for research and development applications across multiple scientific domains. The human-derived sequence ensures relevance to physiological studies, while its well-characterized mechanisms of action provide a robust foundation for experimental reproducibility and translational research. Researchers value its ability to modulate complex signaling pathways, making it a versatile tool for elucidating the molecular underpinnings of cardiovascular and renal physiology.

Cardiovascular Research: In the field of cardiovascular research, Brain Natriuretic Peptide is extensively utilized to investigate the molecular and cellular responses of cardiac tissues to hemodynamic stress. By applying this peptide to in vitro or ex vivo cardiac models, scientists can simulate conditions of volume overload and assess downstream effects on gene expression, cellular hypertrophy, and fibrosis. Its interaction with natriuretic peptide receptors, particularly NPR-A, enables the study of cyclic guanosine monophosphate (cGMP)-mediated signaling cascades, offering insights into the regulation of vascular tone and myocardial remodeling. Such research is instrumental in advancing the understanding of heart failure pathophysiology and the identification of novel therapeutic targets.

Renal Physiology Studies: The application of Human Brain Natriuretic Peptide in renal physiology research provides a valuable approach to examining its effects on glomerular filtration rate, sodium excretion, and water balance. Researchers employ this peptide in isolated kidney preparations or renal cell cultures to delineate its role in modulating renal hemodynamics and tubular transport mechanisms. By activating guanylyl cyclase-linked receptors in the kidney, it facilitates the study of natriuresis and diuresis, contributing to a deeper comprehension of fluid and electrolyte homeostasis. This knowledge is critical for unraveling the complex interplay between cardiac and renal systems under both physiological and pathophysiological conditions.

Signal Transduction Analysis: Scientists leverage Brain Natriuretic Peptide as a molecular probe to dissect intracellular signaling pathways, particularly those involving second messengers such as cGMP. The peptide's ability to activate specific receptor subtypes allows for the precise mapping of downstream effectors, including protein kinase G and phosphodiesterases. Through the use of biochemical assays, gene reporter systems, and advanced imaging techniques, researchers can quantify changes in signal transduction dynamics, identify regulatory feedback loops, and explore cross-talk with other hormonal pathways. These studies enhance the broader understanding of cellular communication networks and their implications for cardiovascular and renal function.

Pharmacological Screening: In drug discovery and pharmacological research, Human Brain Natriuretic Peptide serves as a reference compound or positive control in high-throughput screening assays designed to identify modulators of the natriuretic peptide pathway. Its well-characterized receptor binding properties and downstream signaling effects provide a reliable benchmark for evaluating the efficacy and specificity of novel small molecules, peptides, or biologics. By incorporating it into functional assays, researchers can efficiently assess compound potency, selectivity, and mechanism of action, thereby accelerating the development of innovative therapeutic candidates targeting cardiovascular and renal diseases.

Biomarker Validation: The use of Brain Natriuretic Peptide in biomarker validation studies supports the development and optimization of quantitative assays for monitoring changes in peptide levels under various experimental conditions. Scientists utilize it as a calibrator or standard in immunoassays, mass spectrometry, and other analytical platforms to ensure accuracy and reproducibility in peptide quantification. These efforts facilitate the correlation of peptide dynamics with physiological or pathological states, providing essential data for basic research and translational applications. Collectively, the versatility and scientific relevance of Human Brain Natriuretic Peptide make it an indispensable tool for advancing research across cardiovascular, renal, molecular signaling, pharmacological, and biomarker domains.

Source#
Synthetic
Solubility
−20°C
Organism
Human
BoilingPoint
N/A
References

Higher BNP concentrations early after first myocardial infarction are associated with adverse left ventricular remodelling characteristics. This may help explain why BNP is such a strong predictor of outcome after myocardial infarction.

Crilley J G, Farrer M. Left ventricular remodelling and brain natriuretic peptide after first myocardial infarction[J]. Heart, 2001, 86(6): 638-642.

Subtle cardiac abnormalities have been described in patients with cirrhosis. Natriuretic peptide hormones have been reported to be sensitive markers of early cardiac disease. We postulate that plasma levels of N-terminal pro-atrial natriuretic peptide and brain natriuretic peptide could be used as markers of cardiac dysfunction in cirrhosis.

Florence W, Samuel S I U, Peter L I U, et al. Brain natriuretic peptide: is it a predictor of cardiomyopathy in cirrhosis?[J]. Clinical Science, 2001, 101(6): 621-628.

Melting Point
N/A

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServicePeptide Nucleic Acids SynthesisPeptide CDMOPeptide Analysis ServicesPeptide Synthesis ServicesPeptide Modification ServicesEpitope Mapping ServicesCustom Conjugation Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers