Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)

This is a peptide derived from rabies virus glycoprotein (RVG). Because neurotropic viruses cross the blood-brain barrier to infect brain cells, the same strategy may be used to enter the central nervous system and deliver siRNA to the brain. To enable siRNA binding, this chimeric peptide was synthesized by adding nonamer arginine residues at the carboxy terminus of RVG. This RVG-9R peptide was able to bind and transduce siRNA to neuronal cells in vitro, resulting in efficient gene silencing. After intravenous injection into mice,RVG-9R delivered siRNA to the neuronal cells, resulting in specific gene silencing within the brain. RVG-9R provides a safe and noninvasive approach for the delivery of siRNA and potentially other therapeutic molecules across the blood–brain barrier.

Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

CAT No: GR1902

Synonyms/Alias: 1678417-57-6;RVG-9R trifluoroacetate salt H-Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly-Gly-Gly-Gly-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt;

Quick InquiryCustom Peptide Synthesis

Peptide Library Construction and Screening

Powerful screening tools in biological and chemical research

M.F/FormulaC201H334N82O55S2
M.W/Mr.4843
SequenceOne Letter Code:YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
Three Letter Code:H-Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly-Gly-Gly-Gly-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH
Long-term Storage ConditionsFreely soluble in water. Avoid repeated freezing and thawing.
InChIInChI=1S/C201H334N82O55S2/c1-10-98(3)150(276-173(321)130(87-149(301)302)267-176(324)134(97-339)274-180(328)138-55-34-79-283(138)188(336)154(103(8)288)275-147(298)94-249-177(325)135-52-31-76-280(135)185(333)123(50-29-74-241-200(227)228)264-179(327)137-54-33-78-282(137)187(335)131(86-141(206)292)271-169(317)122(60-61-148(299)300)262-178(326)136-53-32-77-281(136)186(334)124(62-80-340-9)263-170(318)127(83-106-88-243-110-38-16-15-37-108(106)110)269-182(330)151(99(4)11-2)277-184(332)153(102(7)287)278-156(304)109(203)81-105-56-58-107(289)59-57-105)181(329)268-126(82-104-35-13-12-14-36-104)172(320)279-152(101(6)286)183(331)270-129(85-140(205)291)171(319)273-133(96-285)174(322)253-111(40-19-64-231-190(207)208)157(305)248-93-146(297)251-112(39-17-18-63-202)160(308)254-114(42-21-66-233-192(211)212)159(307)250-100(5)155(303)272-132(95-284)175(323)266-128(84-139(204)290)158(306)247-91-144(295)245-89-142(293)244-90-143(294)246-92-145(296)252-113(41-20-65-232-191(209)210)161(309)255-115(43-22-67-234-193(213)214)162(310)256-116(44-23-68-235-194(215)216)163(311)257-117(45-24-69-236-195(217)218)164(312)258-118(46-25-70-237-196(219)220)165(313)259-119(47-26-71-238-197(221)222)166(314)260-120(48-27-72-239-198(223)224)167(315)261-121(49-28-73-240-199(225)226)168(316)265-125(189(337)338)51-30-75-242-201(229)230/h12-16,35-38,56-59,88,98-103,109,111-138,150-154,243,284-289,339H,10-11,17-34,39-55,60-87,89-97,202-203H2,1-9H3,(H2,204,290)(H2,205,291)(H2,206,292)(H,244,293)(H,245,295)(H,246,294)(H,247,306)(H,248,305)(H,249,325)(H,250,307)(H,251,297)(H,252,296)(H,253,322)(H,254,308)(H,255,309)(H,256,310)(H,257,311)(H,258,312)(H,259,313)(H,260,314)(H,261,315)(H,262,326)(H,263,318)(H,264,327)(H,265,316)(H,266,323)(H,267,324)(H,268,329)(H,269,330)(H,270,331)(H,271,317)(H,272,303)(H,273,319)(H,274,328)(H,275,298)(H,276,321)(H,277,332)(H,278,304)(H,279,320)(H,299,300)(H,301,302)(H,337,338)(H4,207,208,231)(H4,209,210,232)(H4,211,212,233)(H4,213,214,234)(H4,215,216,235)(H4,217,218,236)(H4,219,220,237)(H4,221,222,238)(H4,223,224,239)(H4,225,226,240)(H4,227,228,241)(H4,229,230,242)/t98-,99-,100-,101+,102+,103+,109-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,150-,151-,152-,153-,154-/m0/s1
InChI KeyDBGVIKDHBPWMLR-ICHOMJBYSA-N
Write a review Ask a question
My Review for Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)

Required fields are marked with *

  • Basic Information
×
Ask a Question for Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)

Required fields are marked with *

  • Basic Information
×
Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.

Featured Services
Hot Products
  • Terlipressin

    Terlipressin is a synthetic triglycyllysine derivative of vasopressin with vasoconstrictive, antihemorrhagic, and antidiuretic properties. Upon intravenous administration, terlipressin, an inactive prodrug, is biotransformed to its active moiety, lysine vasopressin (LVP), a nonselective vasopressin analogue with affinity for vasopressin receptors V1 (V1a), V2 and V3 (V1b). As a V1 agonist, terlipressin increases systemic vascular resistance, particularly in the splanchnic area, resulting in a decrease of portal pressure. V1 binding also promotes platelet aggregation and glycogenolysis, while V3 binding induces adrenocorticotropic hormone (ACTH) secretion. Compared to vasopressin, terlipressin has a minimal effect on V2 receptors, which are responsible for promotion of water reabsorption in the collecting ducts of the kidney via stimulation of cyclic AMP production.

    Inquiry
  • Thymopentin Acetate

    Thymopentin, also known as TP-5, is a synthetic derivative of thymopoietin, a thymic hormone, and has immunoregulatory properties. Thymopentin interacts with T cells, reduces endocrine and behavioral responses to experimental stress. It is also found to increase the number of cells undergoing apoptosis in irradiated cells and selectively bind to apoptotic cells.

    Inquiry
  • Lanreotide Acetate

    Lanreotide is a a synthetic cyclic octapeptide analogue of somatostatin. Lanreotide inhibits the secretion of growth hormone (GH) by binding to pituitary somatostatin receptors, and may inhibit the release of various other hormones, including thyroid stimulating hormone (TSH) and the gastroenteropancreatic hormones insulin, glucagon and gastrin.

    Inquiry
  • Argipressin

    Vasopressin, also known as arginine vasopressin (AVP), antidiuretic hormone (ADH), or argipressin, is a neurohypophysial hormone found in most mammals. Its two primary functions are to retain water in the body and to constrict blood vessels.

    Inquiry
  • Deslorelin Acetate

    Deslorelin acetate is an injectable gonadotropin releasing hormone super-agonist (GnRH agonist) also known as an LHRH agonist. It stops the production of sex hormones (testosterone and oestrogen).

    Inquiry
  • Deslorelin

    Deslorelin is a gonadotropin releasing hormone super-agonist (GnRH agonist) also known as an LHRH agonist. It stops the production of sex hormones (testosterone and oestrogen). It is currently approved for use in veterinary medicine and is used to induce ovulation in mares as part of the artificial insemination process. It is also used to stabilize high-risk pregnancies, mainly of livestock. Unlike other GnRH agonists, which are mainly used to inhibit luteinizing hormone and follicle-stimulating hormone by their ultimate downregulation of the pituitary gland.

    Inquiry
  • Somatostatin

    Somatostatin is a tetradecapeptide which can suppress the growth hormone (GH) secretion and control the pituitary hormone secretion in human CNS.

    Inquiry
  • Teriparatide Acetate

    Teriparatide(recombinant human parathyroid hormone) /PTH (1-34) (human) corresponds to the N-terminal part of human parathyroid hormone, a peptide consisting of 84 amino acids.

    Inquiry
  • Icatibant

    Icatibant (Firazyr) is a synthetic peptidomimetic drug consisting of ten amino acids, and acts as an effective and specific antagonist of bradykinin B2 receptors. It has been approved in the EU for use in hereditary angioedema, and is under investigation for a number of other conditions in which bradykinin is thought to play a significant role.

    Inquiry
  • Terlipressin Acetate

    Terlipressin acetate is a vasopressin analogue with potent vasoactive properties. Terlipressin acetate is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin acetate exerts anti-inflammatory and anti-oxidative effects. Terlipressin acetate has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research.

    Inquiry
  • Terlipressin

    Terlipressin is a synthetic triglycyllysine derivative of vasopressin with vasoconstrictive, antihemorrhagic, and antidiuretic properties. Upon intravenous administration, terlipressin, an inactive prodrug, is biotransformed to its active moiety, lysine vasopressin (LVP), a nonselective vasopressin analogue with affinity for vasopressin receptors V1 (V1a), V2 and V3 (V1b). As a V1 agonist, terlipressin increases systemic vascular resistance, particularly in the splanchnic area, resulting in a decrease of portal pressure. V1 binding also promotes platelet aggregation and glycogenolysis, while V3 binding induces adrenocorticotropic hormone (ACTH) secretion. Compared to vasopressin, terlipressin has a minimal effect on V2 receptors, which are responsible for promotion of water reabsorption in the collecting ducts of the kidney via stimulation of cyclic AMP production.

    Inquiry
  • Thymopentin Acetate

    Thymopentin, also known as TP-5, is a synthetic derivative of thymopoietin, a thymic hormone, and has immunoregulatory properties. Thymopentin interacts with T cells, reduces endocrine and behavioral responses to experimental stress. It is also found to increase the number of cells undergoing apoptosis in irradiated cells and selectively bind to apoptotic cells.

    Inquiry
  • Lanreotide Acetate

    Lanreotide is a a synthetic cyclic octapeptide analogue of somatostatin. Lanreotide inhibits the secretion of growth hormone (GH) by binding to pituitary somatostatin receptors, and may inhibit the release of various other hormones, including thyroid stimulating hormone (TSH) and the gastroenteropancreatic hormones insulin, glucagon and gastrin.

    Inquiry
  • Argipressin

    Vasopressin, also known as arginine vasopressin (AVP), antidiuretic hormone (ADH), or argipressin, is a neurohypophysial hormone found in most mammals. Its two primary functions are to retain water in the body and to constrict blood vessels.

    Inquiry
  • Deslorelin Acetate

    Deslorelin acetate is an injectable gonadotropin releasing hormone super-agonist (GnRH agonist) also known as an LHRH agonist. It stops the production of sex hormones (testosterone and oestrogen).

    Inquiry
Get in touch with us

Copyright © 2025 Creative Peptides. All rights reserved.

We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy

Accept Cookies
x