Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)

This is a peptide derived from rabies virus glycoprotein (RVG). Because neurotropic viruses cross the blood-brain barrier to infect brain cells, the same strategy may be used to enter the central nervous system and deliver siRNA to the brain. To enable siRNA binding, this chimeric peptide was synthesized by adding nonamer arginine residues at the carboxy terminus of RVG. This RVG-9R peptide was able to bind and transduce siRNA to neuronal cells in vitro, resulting in efficient gene silencing. After intravenous injection into mice,RVG-9R delivered siRNA to the neuronal cells, resulting in specific gene silencing within the brain. RVG-9R provides a safe and noninvasive approach for the delivery of siRNA and potentially other therapeutic molecules across the blood–brain barrier.

Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

CAT No: GR1902

Synonyms/Alias: 1678417-57-6;RVG-9R trifluoroacetate salt H-Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly-Gly-Gly-Gly-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt;

Quick InquiryCustom Peptide Synthesis

Peptide Library Construction and Screening

Powerful screening tools in biological and chemical research

M.F/FormulaC201H334N82O55S2
M.W/Mr.4843
SequenceOne Letter Code:YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
Three Letter Code:H-Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly-Gly-Gly-Gly-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH
Long-term Storage ConditionsFreely soluble in water. Avoid repeated freezing and thawing.
InChIInChI=1S/C201H334N82O55S2/c1-10-98(3)150(276-173(321)130(87-149(301)302)267-176(324)134(97-339)274-180(328)138-55-34-79-283(138)188(336)154(103(8)288)275-147(298)94-249-177(325)135-52-31-76-280(135)185(333)123(50-29-74-241-200(227)228)264-179(327)137-54-33-78-282(137)187(335)131(86-141(206)292)271-169(317)122(60-61-148(299)300)262-178(326)136-53-32-77-281(136)186(334)124(62-80-340-9)263-170(318)127(83-106-88-243-110-38-16-15-37-108(106)110)269-182(330)151(99(4)11-2)277-184(332)153(102(7)287)278-156(304)109(203)81-105-56-58-107(289)59-57-105)181(329)268-126(82-104-35-13-12-14-36-104)172(320)279-152(101(6)286)183(331)270-129(85-140(205)291)171(319)273-133(96-285)174(322)253-111(40-19-64-231-190(207)208)157(305)248-93-146(297)251-112(39-17-18-63-202)160(308)254-114(42-21-66-233-192(211)212)159(307)250-100(5)155(303)272-132(95-284)175(323)266-128(84-139(204)290)158(306)247-91-144(295)245-89-142(293)244-90-143(294)246-92-145(296)252-113(41-20-65-232-191(209)210)161(309)255-115(43-22-67-234-193(213)214)162(310)256-116(44-23-68-235-194(215)216)163(311)257-117(45-24-69-236-195(217)218)164(312)258-118(46-25-70-237-196(219)220)165(313)259-119(47-26-71-238-197(221)222)166(314)260-120(48-27-72-239-198(223)224)167(315)261-121(49-28-73-240-199(225)226)168(316)265-125(189(337)338)51-30-75-242-201(229)230/h12-16,35-38,56-59,88,98-103,109,111-138,150-154,243,284-289,339H,10-11,17-34,39-55,60-87,89-97,202-203H2,1-9H3,(H2,204,290)(H2,205,291)(H2,206,292)(H,244,293)(H,245,295)(H,246,294)(H,247,306)(H,248,305)(H,249,325)(H,250,307)(H,251,297)(H,252,296)(H,253,322)(H,254,308)(H,255,309)(H,256,310)(H,257,311)(H,258,312)(H,259,313)(H,260,314)(H,261,315)(H,262,326)(H,263,318)(H,264,327)(H,265,316)(H,266,323)(H,267,324)(H,268,329)(H,269,330)(H,270,331)(H,271,317)(H,272,303)(H,273,319)(H,274,328)(H,275,298)(H,276,321)(H,277,332)(H,278,304)(H,279,320)(H,299,300)(H,301,302)(H,337,338)(H4,207,208,231)(H4,209,210,232)(H4,211,212,233)(H4,213,214,234)(H4,215,216,235)(H4,217,218,236)(H4,219,220,237)(H4,221,222,238)(H4,223,224,239)(H4,225,226,240)(H4,227,228,241)(H4,229,230,242)/t98-,99-,100-,101+,102+,103+,109-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,150-,151-,152-,153-,154-/m0/s1
InChI KeyDBGVIKDHBPWMLR-ICHOMJBYSA-N
Write a review Ask a question
My Review for Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)

Required fields are marked with *

  • Basic Information
×
Ask a Question for Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)

Required fields are marked with *

  • Basic Information
×
Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.

Featured Services
Hot Products
  • Antide

    Antide acetate (Ac-AA10-NH2) is an LHRH antagonist and represses LH and FSH release from the pituitary gland. It shows a high antiovulatory activity and releases negligible histamine.

    Inquiry
  • Teriparatide Acetate

    Teriparatide(recombinant human parathyroid hormone) /PTH (1-34) (human) corresponds to the N-terminal part of human parathyroid hormone, a peptide consisting of 84 amino acids.

    Inquiry
  • Icatibant

    Icatibant (Firazyr) is a synthetic peptidomimetic drug consisting of ten amino acids, and acts as an effective and specific antagonist of bradykinin B2 receptors. It has been approved in the EU for use in hereditary angioedema, and is under investigation for a number of other conditions in which bradykinin is thought to play a significant role.

    Inquiry
  • Fertirelin Acetate

    Fertirelin acetate is a potent LHRH agonist. After a transient increase, continuous administration results in downregulation of LH and FSH levels followed by a suppression of ovarian and testicular steroid biosynthesis.

    Inquiry
  • Angiotensin II

    Angiotensin II human (Angiotensin II) is a vasoconstrictor that mainly acts on the AT1 receptor. Angiotensin II human stimulates sympathetic nervous stimulation, increases aldosterone biosynthesis and renal actions. Angiotensin II human induces growth of vascular smooth muscle cells, increases collagen type I and III synthesis in fibroblasts, leading to thickening of the vascular wall and myocardium, and fibrosis. Angiotensin II human also induces apoptosis.

    Inquiry
  • Glucagon

    Glucagon (Porcine glucagon) is a peptide hormone, produced by pancreatic α-cells. Glucagon stimulates gluconeogenesis. Glucagon decreases the activity of HNF-4. Glucagon increases HNF4α phosphorylation.

    Inquiry
  • Elcatonin Acetate

    Elcatonin acetate inhibits the absorption and autolysis of bones, thus leads to blood calcium descending. In addition, it inhibits the bone salts dissolving and transferring and promotes the excretion of calcium and phosphorus in urine.

    Inquiry
  • Argipressin

    Vasopressin, also known as arginine vasopressin (AVP), antidiuretic hormone (ADH), or argipressin, is a neurohypophysial hormone found in most mammals. Its two primary functions are to retain water in the body and to constrict blood vessels.

    Inquiry
  • Alarelin acetate

    Alarelin acetate is a synthetic LH-RH agonist, and stimulates the release of FSH and LH from the pituitary gland. It is known for its induction of ovulation and used to treat endmometriosis.

    Inquiry
  • Deslorelin Acetate

    Deslorelin acetate is an injectable gonadotropin releasing hormone super-agonist (GnRH agonist) also known as an LHRH agonist. It stops the production of sex hormones (testosterone and oestrogen).

    Inquiry
Get in touch with us

Copyright © 2025 Creative Peptides. All rights reserved.