Exendins and Fragments

Exendin-3

Price Inquiry
CAT#
E10003
Sequence
SDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
M.W/Mr.
4202.7
Molecular Formula
C184H282N50O61S1
Length
38

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.