We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy
Insulin cattle is a kind of polypeptide hormone that regulates glucose metabolism in pancreatic islet B-cells.
CAT No: R1453
CAS No: 11070-73-8
Synonyms/Alias: Insulin from bovine pancreas
Quick InquiryCustom Peptide SynthesisPeptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C₂₅₄H₃₇₇N₆₅O₇₅S₆ |
M.W/Mr. | 5733.49 |
Sequence | One Letter Code: FVNQHLCGSHLVEALYLVCGERGFFYTPKA. GIVEQCCASVCSLYQLENYCN (Disulfide bridge: Cys7-Cys7', Cys19-Cys20', Cys6'-Cys11') three Letter Code: Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Ala. Gly-Ile-Val-Glu-Gln-Cys-Cys-Ala-Ser-Val-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn (Disulfide bridge: Cys7-Cys7', Cys19-Cys20', Cys6' |
3. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
5. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.