Insulin(cattle)

Insulin cattle is a kind of polypeptide hormone that regulates glucose metabolism in pancreatic islet B-cells.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1453

CAS No:11070-73-8

Synonyms/Alias:Insulin from bovine pancreas

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₂₅₄H₃₇₇N₆₅O₇₅S₆
M.W/Mr.
5733.49
Sequence
One Letter Code: FVNQHLCGSHLVEALYLVCGERGFFYTPKA. GIVEQCCASVCSLYQLENYCN (Disulfide bridge: Cys7-Cys7', Cys19-Cys20', Cys6'-Cys11')
three Letter Code: Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Ala. Gly-Ile-Val-Glu-Gln-Cys-Cys-Ala-Ser-Val-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn (Disulfide bridge: Cys7-Cys7', Cys19-Cys20', Cys6'

Insulin (cattle) is a polypeptide hormone derived from bovine sources, structurally composed of two peptide chains linked by disulfide bonds. As a fundamental regulator of glucose metabolism in mammals, it plays a pivotal role in modulating carbohydrate, lipid, and protein homeostasis. Due to its high degree of sequence homology with human insulin and well-characterized biochemical properties, bovine insulin has long served as a reference material and functional analog in diverse research and industrial contexts. Its stability, biological activity, and established performance in experimental systems make it a valuable tool for probing the molecular mechanisms underlying insulin signaling, metabolic regulation, and endocrine function.

Metabolic research: Bovine insulin is widely utilized in studies investigating the molecular and cellular mechanisms of glucose uptake, glycogen synthesis, and lipid metabolism. Researchers employ it to stimulate insulin-responsive pathways in cultured cells, isolated tissues, and animal models, allowing detailed examination of insulin receptor signaling cascades, downstream effectors such as PI3K/Akt, and cross-talk with other metabolic regulators. By providing a consistent and well-characterized stimulus, it facilitates the elucidation of insulin's role in metabolic homeostasis and the pathophysiology of insulin resistance.

Cell culture supplementation: In vitro systems often require exogenous insulin to support the growth and maintenance of certain mammalian cell lines, particularly adipocytes, hepatocytes, and myocytes. Bovine insulin is frequently added to serum-free or defined media to promote cellular glucose uptake, enhance viability, and stimulate anabolic processes. Its inclusion in culture protocols enables the study of insulin-dependent cellular differentiation, gene expression, and metabolic flux under controlled conditions, supporting a broad range of biochemical and pharmacological investigations.

Receptor binding and signaling assays: The use of bovine insulin as a ligand in receptor binding studies allows for precise quantification of insulin receptor density, affinity, and downstream activation. Radiolabeled or fluorescently tagged forms are employed to map receptor-ligand interactions, assess receptor internalization, and monitor signal transduction events. Such assays provide essential insights into receptor dynamics, ligand specificity, and the effects of mutations or modulators on insulin action, informing both basic research and the development of novel therapeutic agents.

Protein engineering and analog development: The structural and functional similarity of bovine insulin to its human counterpart makes it a valuable model for protein engineering studies. Researchers utilize it as a template for site-directed mutagenesis, peptide mapping, and the generation of insulin analogs with modified pharmacokinetic or receptor-binding properties. These efforts advance the understanding of structure-activity relationships and support the rational design of improved insulin variants for research applications.

Analytical method calibration: Bovine insulin serves as a standard in the calibration and validation of analytical techniques such as high-performance liquid chromatography (HPLC), mass spectrometry, and immunoassays. Its defined composition and consistent performance enable accurate quantification of insulin and related peptides in complex biological samples. By providing a reliable reference material, it underpins the reproducibility and comparability of biochemical analyses across laboratories and experimental platforms.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicesPeptide Nucleic Acids SynthesisCustom Conjugation ServicePeptide Modification ServicesPeptide CDMOEpitope Mapping ServicescGMP Peptide ServicePeptide Analysis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers