CAT# | P13001 |
M.F/Formula | C156H242N54O43S |
M.W/Mr. | 3594.04 |
Sequence | SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2 |
Length | 31 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
P13004 | Prolactin Releasing Peptide (12-31), bovine | Inquiry | ||
P13006 | Prolactin Releasing Peptide (12-31), rat | Inquiry | ||
P13002 | Prolactin Releasing Peptide (1-31), bovine | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Myristoyl pentapeptide-8, a cosmetic peptide, is a synthetic peptide containing arginine, aspartic acid, glycine ...
In 1979, GOLDSTEIN et al. extracted an opioid-active 17 peptide from the pituitary of pigs and named it dynorphi ...
Carnosine (β-alanyl-l-histidine), containing an imidazole moiety, is an intramuscular dipeptide consisting of β ...
KAI-1455, a ε-protein kinase C activator in Phase I testing for the treatment of ischemia-induced reperfusion i ...
IGF-1 IGF-1 is a single chain peptide consists of 70 amino acids in four domains, B, C, A and D. The A- and B-domains are str ...