Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C156H242N54O43S |
M.W/Mr. | 3594.04 |
Sequence | SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2 |
Length | 31 |
2. The spatiotemporal control of signalling and trafficking of the GLP-1R
3. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
5. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.