Keywords Search Google Search Search

Prolactin-Releasing Peptide (1-31), rat

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	P13001
M.F/Formula	C156H242N54O43S
M.W/Mr.	3594.04
Sequence	SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2

CAT#	Product Name	Inquiry
P13002	Prolactin Releasing Peptide (1-31), bovine	Inquiry
P13004	Prolactin Releasing Peptide (12-31), bovine	Inquiry
P13006	Prolactin Releasing Peptide (12-31), rat	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The Function of Deferasirox in Iron Overload

Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...

Function of KYL Solution on the Cold Preservation of Liver

Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...

The application of obestatin (human) in hormonal therapy

Obestatin is a 23-amino acid peptide hormone produced in specific epithelial cells of the stomach and small inte ...

Function of perindopril erbumine in hypertension

Perindopril erbumine is an angiotensioncon vertingenzyme (ACE) inhibitor without sulfhydryl group. It is a chi ...

A synthetic analogue of vasopressin - felypressin

Vasoconstrictor substances, such as norepinephrine and epinephrine, have been mingled with local anesthetics to ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: