Prolactin-Releasing Peptide (1-31), rat

Prolactin-Releasing Peptide (1-31), rat contains conserved motifs associated with peptide hormone folding. Sequence features allow exploration of ligand-binding regions. Conformational dynamics enhance understanding of biosynthetic processing. Researchers apply it in neuroendocrine structure-function research.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: P13001

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C156H242N54O43S
M.W/Mr.
3594.04
Sequence
SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2
Length
31

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOCustom Conjugation ServicePeptide Synthesis ServicesPeptide Analysis ServicesEpitope Mapping ServicesPeptide Modification ServicescGMP Peptide ServicePeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers