Keywords Search Google Search Search

Beta Amyloid (3-40)

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	A13246
M.F/Formula	C187H285N51O54S1
M.W/Mr.	4141.0
Sequence	EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

CAT#	Product Name	Inquiry
A13184	Beta-Amyloid (6-30)	Inquiry
A13272	[Gln11]-beta-Amyloid (1-40)	Inquiry
A13369	β-Amyloid (33-42)	Inquiry
A13312	[Met]-beta-Amyloid (1-42), mouse, rat	Inquiry
A13248	Beta-Amyloid (4-42)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The opiate delta receptor antagonist-ICI 154,129

ICl 154,129 is a new compound that shows selectivity as an antagonist of [Leu5]enkephalin and [D-AIa2, D-Leu5]en ...

Function of KYL Solution on the Cold Preservation of Liver

Appropriate perfusion preservation solution is of great significance for reducing or slowing down various damage ...

Tachykinin NK2 receptor antagonist-MEN 10376

MEN 10376 (Asp-Tyr-D-Trp-Val-D-Trp-D-Trp-Lys-NH2) is an analogue of Neurokinin A (NKA), which has a selective af ...

The mechanism of R18 on 14-3-3 protein

R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...

The Function of Aviptadil Acetate on the Treatment of Pulmonary Arterial Hypertension

Aviptadil acetate, the nonproprietary or generic name for a vasoactive intestinal peptide (VIP), is a synthetic ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: