Exendin 3 (9-39)

Exendin-3 (9-39) is a potent and selecive GLP-1 receptor antagonist.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Exendin 3 (9-39)(CAS 133514-43-9)

CAT No: R1827

CAS No:133514-43-9

Synonyms/Alias:133514-43-9;Exendin (9-39);Avexitide;exendin(9-39);Asp-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TR|p|-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-;DTXSID00158156;Exendin (9-39) Acetate;exendin-(9-39) amide;Exendin-3 9-39)amide;Exendin-3 (9-39);Exendin-3-(9-39) amide;GTPL1138;CHEMBL4070972;GTPL13444;GLXC-27747;EX-A7432;AKOS024456934;AS-83777;CID 16198321;DA-73276;FE110341;exendin 3 [Heloderma horridum horridum (Mexican beaded lizard)] (9-39)-peptide 39-amide (from INN record);

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C149H234N40O47S
M.W/Mr.
3369.8
Sequence
One Letter Code:DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Three Letter Code:H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Purity
≥95%

Exendin 3 (9-39) is a synthetic peptide fragment derived from the exendin-3 sequence, specifically lacking the first eight amino acids. As a truncated analog of exendin peptides, it is renowned for its ability to function as a competitive antagonist at the glucagon-like peptide-1 (GLP-1) receptor. This property has made it a valuable research tool in metabolic, endocrinological, and receptor pharmacology studies, where precise modulation of GLP-1 signaling is required. Its structural features and high specificity for GLP-1 receptors support a wide range of investigative applications in peptide biology and receptor-ligand interaction research.

Receptor antagonist studies: Exendin 3 (9-39) is extensively employed to probe the physiological and cellular effects mediated by GLP-1 receptor activation. By competitively inhibiting endogenous or exogenous GLP-1 agonists, it enables researchers to delineate the direct consequences of GLP-1 receptor blockade in various cell types and tissues. This approach is essential for dissecting the specific contributions of GLP-1 signaling in metabolic regulation, hormone secretion, and related pathways.

Signal transduction analysis: The peptide serves as a precise tool for mapping downstream signaling cascades initiated by GLP-1 receptor engagement. By selectively inhibiting receptor activation, investigators can measure changes in intracellular second messengers, such as cyclic AMP, and assess alterations in kinase activity or gene expression profiles. This facilitates a detailed understanding of the molecular mechanisms underlying GLP-1-dependent processes and supports the development of models for receptor-mediated signal transduction.

Metabolic research: In studies focused on glucose homeostasis, insulin secretion, and energy balance, exendin 3 (9-39) provides a robust means of evaluating the physiological relevance of GLP-1 signaling. Its antagonistic action allows for controlled experimentation on pancreatic islet function, hepatic glucose production, and peripheral glucose uptake. Researchers leverage this peptide to elucidate the interplay between incretin hormones and metabolic pathways, contributing to foundational knowledge in diabetes and obesity research.

Pharmacological profiling: The use of exendin 3 (9-39) in pharmacological assays enables detailed characterization of novel GLP-1 receptor ligands, including their potency, efficacy, and receptor selectivity. By serving as a reference antagonist, it assists in distinguishing specific GLP-1 receptor-mediated responses from off-target effects in both in vitro and ex vivo systems. This is particularly valuable for drug discovery efforts and structure-activity relationship studies involving incretin mimetics or related peptides.

Peptide-receptor interaction studies: Beyond its functional applications, exendin 3 (9-39) is instrumental in structural and biophysical investigations of peptide-receptor interactions. Its well-defined sequence and receptor specificity make it suitable for binding assays, affinity measurements, and studies employing techniques such as surface plasmon resonance or isothermal titration calorimetry. These approaches provide quantitative insights into the molecular determinants of GLP-1 receptor recognition and antagonism, advancing both basic and applied peptide science.

Long-term Storage Conditions
Soluble in water. H2O : 50 mg/mL
Shipping Condition
Room Temperature in continental US; may vary elsewhere
InChI
InChI=1S/C149H234N40O47S/c1-14-78(10)120(185-139(227)98(62-81-29-16-15-17-30-81)177-136(224)97(61-76(6)7)175-129(217)88(35-24-53-158-149(156)157)172-144(232)119(77(8)9)184-122(210)79(11)164-126(214)90(41-46-114(199)200)168-131(219)91(42-47-115(201)202)169-132(220)92(43-48-116(203)204)170-134(222)94(50-58-237-13)171-130(218)89(40-45-109(153)194)167-127(215)86(33-20-22-51-150)166-140(228)103(72-192)182-137(225)95(59-74(2)3)174-123(211)84(152)64-118(207)208)145(233)173-93(44-49-117(205)206)133(221)178-99(63-82-66-159-85-32-19-18-31-83(82)85)138(226)176-96(60-75(4)5)135(223)165-87(34-21-23-52-151)128(216)179-100(65-110(154)195)124(212)161-67-111(196)160-69-113(198)186-54-25-36-105(186)142(230)183-104(73-193)141(229)181-102(71-191)125(213)162-68-112(197)163-80(12)146(234)188-56-27-38-107(188)148(236)189-57-28-39-108(189)147(235)187-55-26-37-106(187)143(231)180-101(70-190)121(155)209/h15-19,29-32,66,74-80,84,86-108,119-120,159,190-193H,14,20-28,33-65,67-73,150-152H2,1-13H3,(H2,153,194)(H2,154,195)(H2,155,209)(H,160,196)(H,161,212)(H,162,213)(H,163,197)(H,164,214)(H,165,223)(H,166,228)(H,167,215)(H,168,219)(H,169,220)(H,170,222)(H,171,218)(H,172,232)(H,173,233)(H,174,211)(H,175,217)(H,176,226)(H,177,224)(H,178,221)(H,179,216)(H,180,231)(H,181,229)(H,182,225)(H,183,230)(H,184,210)(H,185,227)(H,199,200)(H,201,202)(H,203,204)(H,205,206)(H,207,208)(H4,156,157,158)/t78-,79-,80-,84-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,119-,120-/m0/s1
InChI Key
WSEVKKHALHSUMB-MVNVRWBSSA-N
Canonical SMILES
CCC(C)C(C(=O)NC(CCC(=O)O)C(=O)NC(CC1=CNC2=CC=CC=C21)C(=O)NC(CC(C)C)C(=O)NC(CCCCN)C(=O)NC(CC(=O)N)C(=O)NCC(=O)NCC(=O)N3CCCC3C(=O)NC(CO)C(=O)NC(CO)C(=O)NCC(=O)NC(C)C(=O)N4CCCC4C(=O)N5CCCC5C(=O)N6CCCC6C(=O)NC(CO)C(=O)N)NC(=O)C(CC7=CC=CC=C7)NC(=O)C(CC(C)C)NC(=O)C(CCCNC(=N)N)NC(=O)C(C(C)C)NC(=O)C(C)NC(=O)C(CCC(=O)O)NC(=O)C(CCC(=O)O)NC(=O)C(CCC(=O)O)NC(=O)C(CCSC)NC(=O)C(CCC(=O)N)NC(=O)C(CCCCN)NC(=O)C(CO)NC(=O)C(CC(C)C)NC(=O)C(CC(=O)O)N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicescGMP Peptide ServiceCustom Conjugation ServicePeptide Synthesis ServicesPeptide CDMOEpitope Mapping ServicesPeptide Nucleic Acids SynthesisPeptide Analysis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers