Exendin 3 (9-39)

Exendin-3 (9-39) is a potent and selecive GLP-1 receptor antagonist.

Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Exendin 3 (9-39)(CAS 133514-43-9)

CAT No: R1827

CAS No: 133514-43-9

Synonyms/Alias: 133514-43-9;Exendin (9-39);Avexitide;exendin(9-39);Asp-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TR|p|-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-;DTXSID00158156;Exendin (9-39) Acetate;exendin-(9-39) amide;Exendin-3 9-39)amide;Exendin-3 (9-39);Exendin-3-(9-39) amide;GTPL1138;CHEMBL4070972;GTPL13444;GLXC-27747;EX-A7432;AKOS024456934;AS-83777;CID 16198321;DA-73276;FE110341;exendin 3 [Heloderma horridum horridum (Mexican beaded lizard)] (9-39)-peptide 39-amide (from INN record);

Quick InquiryCustom Peptide Synthesis

Peptide Library Construction and Screening

Powerful screening tools in biological and chemical research

M.F/FormulaC149H234N40O47S
M.W/Mr.3369.8
SequenceOne Letter Code:DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Three Letter Code:H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
Purity≥95%
Long-term Storage ConditionsSoluble in water. H2O : 50 mg/mL
Shipping ConditionRoom Temperature in continental US; may vary elsewhere
InChIInChI=1S/C149H234N40O47S/c1-14-78(10)120(185-139(227)98(62-81-29-16-15-17-30-81)177-136(224)97(61-76(6)7)175-129(217)88(35-24-53-158-149(156)157)172-144(232)119(77(8)9)184-122(210)79(11)164-126(214)90(41-46-114(199)200)168-131(219)91(42-47-115(201)202)169-132(220)92(43-48-116(203)204)170-134(222)94(50-58-237-13)171-130(218)89(40-45-109(153)194)167-127(215)86(33-20-22-51-150)166-140(228)103(72-192)182-137(225)95(59-74(2)3)174-123(211)84(152)64-118(207)208)145(233)173-93(44-49-117(205)206)133(221)178-99(63-82-66-159-85-32-19-18-31-83(82)85)138(226)176-96(60-75(4)5)135(223)165-87(34-21-23-52-151)128(216)179-100(65-110(154)195)124(212)161-67-111(196)160-69-113(198)186-54-25-36-105(186)142(230)183-104(73-193)141(229)181-102(71-191)125(213)162-68-112(197)163-80(12)146(234)188-56-27-38-107(188)148(236)189-57-28-39-108(189)147(235)187-55-26-37-106(187)143(231)180-101(70-190)121(155)209/h15-19,29-32,66,74-80,84,86-108,119-120,159,190-193H,14,20-28,33-65,67-73,150-152H2,1-13H3,(H2,153,194)(H2,154,195)(H2,155,209)(H,160,196)(H,161,212)(H,162,213)(H,163,197)(H,164,214)(H,165,223)(H,166,228)(H,167,215)(H,168,219)(H,169,220)(H,170,222)(H,171,218)(H,172,232)(H,173,233)(H,174,211)(H,175,217)(H,176,226)(H,177,224)(H,178,221)(H,179,216)(H,180,231)(H,181,229)(H,182,225)(H,183,230)(H,184,210)(H,185,227)(H,199,200)(H,201,202)(H,203,204)(H,205,206)(H,207,208)(H4,156,157,158)/t78-,79-,80-,84-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,119-,120-/m0/s1
InChI KeyWSEVKKHALHSUMB-MVNVRWBSSA-N
Canonical SMILESCCC(C)C(C(=O)NC(CCC(=O)O)C(=O)NC(CC1=CNC2=CC=CC=C21)C(=O)NC(CC(C)C)C(=O)NC(CCCCN)C(=O)NC(CC(=O)N)C(=O)NCC(=O)NCC(=O)N3CCCC3C(=O)NC(CO)C(=O)NC(CO)C(=O)NCC(=O)NC(C)C(=O)N4CCCC4C(=O)N5CCCC5C(=O)N6CCCC6C(=O)NC(CO)C(=O)N)NC(=O)C(CC7=CC=CC=C7)NC(=O)C(CC(C)C)NC(=O)C(CCCNC(=N)N)NC(=O)C(C(C)C)NC(=O)C(C)NC(=O)C(CCC(=O)O)NC(=O)C(CCC(=O)O)NC(=O)C(CCC(=O)O)NC(=O)C(CCSC)NC(=O)C(CCC(=O)N)NC(=O)C(CCCCN)NC(=O)C(CO)NC(=O)C(CC(C)C)NC(=O)C(CC(=O)O)N
Write a review Ask a question
My Review for Exendin 3 (9-39)

Required fields are marked with *

  • Basic Information
×
Ask a Question for Exendin 3 (9-39)

Required fields are marked with *

  • Basic Information
×
Featured Recommendations
Related Screening Libraries:
Related Small Molecules:
Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.

Featured Services
Hot Products
  • Fertirelin Acetate

    Fertirelin acetate is a potent LHRH agonist. After a transient increase, continuous administration results in downregulation of LH and FSH levels followed by a suppression of ovarian and testicular steroid biosynthesis.

    Inquiry
  • Carperitide

    Atrial Natriuretic Peptide (ANP) (1-28), human, porcine is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. ANP (1-28) inhibits endothelin-1 secretion in a dose-dependent way.

    Inquiry
  • Terlipressin Acetate

    Terlipressin acetate is a vasopressin analogue with potent vasoactive properties. Terlipressin acetate is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin acetate exerts anti-inflammatory and anti-oxidative effects. Terlipressin acetate has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research.

    Inquiry
  • Lanreotide Acetate

    Lanreotide is a a synthetic cyclic octapeptide analogue of somatostatin. Lanreotide inhibits the secretion of growth hormone (GH) by binding to pituitary somatostatin receptors, and may inhibit the release of various other hormones, including thyroid stimulating hormone (TSH) and the gastroenteropancreatic hormones insulin, glucagon and gastrin.

    Inquiry
  • Elcatonin Acetate

    Elcatonin acetate inhibits the absorption and autolysis of bones, thus leads to blood calcium descending. In addition, it inhibits the bone salts dissolving and transferring and promotes the excretion of calcium and phosphorus in urine.

    Inquiry
  • Icatibant

    Icatibant (Firazyr) is a synthetic peptidomimetic drug consisting of ten amino acids, and acts as an effective and specific antagonist of bradykinin B2 receptors. It has been approved in the EU for use in hereditary angioedema, and is under investigation for a number of other conditions in which bradykinin is thought to play a significant role.

    Inquiry
  • Angiotensin II Acetate

    Angiotensin II is an octapeptide that produced from angiotensin I after the removal of two amino acids at the C-terminal by angiotensin-converting enzyme (ACE). Angiotensin II is mediated by AT1 and AT2 receptors, which are seven transmembrane glycoproteins with 30% sequence similarity.

    Inquiry
  • Somatostatin

    Somatostatin is a tetradecapeptide which can suppress the growth hormone (GH) secretion and control the pituitary hormone secretion in human CNS.

    Inquiry
  • Teriparatide Acetate

    Teriparatide(recombinant human parathyroid hormone) /PTH (1-34) (human) corresponds to the N-terminal part of human parathyroid hormone, a peptide consisting of 84 amino acids.

    Inquiry
  • Aviptadil Acetate

    Aviptadil, also known as vasoactive intestinal polypeptide (VIP), is a 28 amino acid neuropeptide that belongs to the glucagon-growth hormone-releasing factor secretion superfamily. Aviptadil acts as a potent systemic vasodilator and bronchodilator. It inhibits the proliferation of vascular and bronchial smooth muscle cells and decreases platelet aggregation. These biological effects are mediated by specific VIP receptors.

    Inquiry
Get in touch with us

Copyright © 2025 Creative Peptides. All rights reserved.