Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GASLSSPAESSGSPQRRGLSAPSSRQIPAPQGAVLVQREKDLPNYNW |
Length | 47 |
Modifications | Phosphotyrosine;Phenylalanine amide |
3. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
4. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
5. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.