Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | WFYQGMNIAIYANIGGVANIIGYTEAAVATLLGAVVAVAPVVP |
Activity | Antibacterial |
Host Chemicals | Propionibacterium freudenreichii subsp. freudenreichii |
Length | 43 |
SwissProt ID | Q6E3K9 |
3. TMEM16F and dynamins control expansive plasma membrane reservoirs
4. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.