CAT# | C29017 |
M.F/Formula | C214H348N60O65S |
M.W/Mr. | 4833.55 |
Sequence | YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2 |
Length | 42 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
C29010 | Antisauvagine-30 | Inquiry | ||
C29005 | α-Helical CRF (12-41) | Inquiry | ||
C29003 | Prepro Corticotropin Releasing Factor (125-151), human | Inquiry | ||
C29009 | Eosinophilotactic Peptide | Inquiry | ||
C29013 | Sauvagine, frog | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
In 1979, GOLDSTEIN et al. extracted an opioid-active 17 peptide from the pituitary of pigs and named it dynorphi ...
Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...
Figure 1. Chemical structure of pentagastrinPentagastrin, known as peptavlon, is a synthetic pentapeptide that p ...
Urantide is a UⅡ receptor antagonist. It can effectively alleviate monocrotaline (MCT)-induced PAH in a rat mode ...
What is abaloparatide? Abaloparatide (formerly known as BA058) is an investigational analog of human PTHrP (1-34) being devel ...