Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | KGKGFWSWASKATSWLTGPQQPGSPLLKKHR |
Activity | Antibacterial |
Host Chemicals | Leuconostoc mesenteroides |
Length | 31 |
SwissProt ID | P81052 |
1. High fat diet and GLP-1 drugs induce pancreatic injury in mice
3. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
4. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.