Keywords Search Google Search Search

Bacteriocin leucocin-B

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2049
Sequence	KGKGFWSWASKATSWLTGPQQPGSPLLKKHR
Activity	Antibacterial

CAT#	Product Name	Inquiry
AF2127	Lucilin, partial	Inquiry
AF1173	Brevinin-1-RAA7 peptide precursor	Inquiry
AF2885	ToAMP4	Inquiry
AF2612	Oxyopinin-2d	Inquiry
AF3348	Rev4	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Bombesin and Bombesin-like peptides

Brief information of bombesin Bombesin is a tetradecapeptide which was originally isolated from Bombina Bombina frog skin the ...

Very Late Antigen-4 blocker-BIO 1211

BIO 1211, is a non-covalent, small-molecule, cyclohexanecarboxylic acid base compound, tight-binding inhibitor ( ...

Function of fertirelin acetate in prostate cancer and other diseases

Fertirelin acetate, classified into peptide hormone, is a gonadotropin-releasing hormone (GnRH) antagonist or ...

Function of elcatonin in treatment of osteoporosis

Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...

The effect of terlipressin acetate in the treatment of decompensated liver cirrhosis

Somatostatin is the main hemostatic drug in the clinic, and its derivative octreotide has been confirmed by many ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Leuconostoc mesenteroides
Length	31
SwissProt ID	P81052