CAT# | AF2049 |
Sequence | KGKGFWSWASKATSWLTGPQQPGSPLLKKHR |
Activity | Antibacterial |
Host Chemicals | Leuconostoc mesenteroides | Length | 31 | SwissProt ID | P81052 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF3043 | Holotricin-1 | Inquiry | ||
AF2368 | Lantibiotic nisin-Z | Inquiry | ||
AF075 | Anoplin | Inquiry | ||
AF101 | PG-SPI | Inquiry | ||
AF950 | Nigrocin-2SCc | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Figure 1. The structural formula of ornipressinOrnipressin is a synthetic analogue of vasopressin, which is repl ...
Conotoxins are small peptides of 12 to 19 amino acids, which act as highly selective antagonists of ion channel ...
The sodium channel subtypes NaV1.2 and NaV1.6 are the two major forms of excitatory pyramidal neurons in the cer ...
APETx2, a 42 amino-acid peptide toxin isolated from sea anemone Anthopleura elegantissima, is a kind of acid-s ...
Somatostatin (SST) is a peptide compound synthesized by neuroendocrine cells and other cells that can label tumo ...