CAT# | AF2049 |
Sequence | KGKGFWSWASKATSWLTGPQQPGSPLLKKHR |
Activity | Antibacterial |
Host Chemicals | Leuconostoc mesenteroides | Length | 31 | SwissProt ID | P81052 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2127 | Lucilin, partial | Inquiry | ||
AF1173 | Brevinin-1-RAA7 peptide precursor | Inquiry | ||
AF2885 | ToAMP4 | Inquiry | ||
AF2612 | Oxyopinin-2d | Inquiry | ||
AF3348 | Rev4 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Brief information of bombesin Bombesin is a tetradecapeptide which was originally isolated from Bombina Bombina frog skin the ...
BIO 1211, is a non-covalent, small-molecule, cyclohexanecarboxylic acid base compound, tight-binding inhibitor ( ...
Fertirelin acetate, classified into peptide hormone, is a gonadotropin-releasing hormone (GnRH) antagonist or ...
Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...
Somatostatin is the main hemostatic drug in the clinic, and its derivative octreotide has been confirmed by many ...