Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C190H283N53O58 |
M.W/Mr. | 4237.7 |
Sequence | GPSQPTYPGDDAPVEDLIRFYDNLQQYLNVVTRHRY-NH2 |
Length | 36 |
1. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
2. Cationic cell-penetrating peptides are potent furin inhibitors
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.