CAT# | P02003 |
M.F/Formula | C190H283N53O58 |
M.W/Mr. | 4237.7 |
Sequence | GPSQPTYPGDDAPVEDLIRFYDNLQQYLNVVTRHRY-NH2 |
Length | 36 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
P02013 | Chromostatin, bovine | Inquiry | ||
P02010 | Apolipoprotein L (306-316) | Inquiry | ||
P02024 | Pancreatic Polypeptide (rana temporaria) | Inquiry | ||
P02021 | Pancreatic Polypeptide (30-53), human | Inquiry | ||
P02011 | BDC2.5 Mimotope | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Glutathione (γ-Glu-Cys-Gly, GSH) is the most abundant antioxidant in animal tissues, at 0.1-10 mM, as well as i ...
APETx2, a 42 amino-acid peptide toxin isolated from sea anemone Anthopleura elegantissima, is a kind of acid-s ...
Enfuvirtide, also named pentafuside, is an HIV fusion inhibitor originated at Duke University, where researchers ...
An overview of Palmitoyl pentapeptide-4 The potential of topical peptides to improve aging skin has been widely discussed in ...
Dipeptide diaminobutyroyl benzylamide diacetate, often marketed under the name Syn-Ake, is a synthetic peptide that mimics th ...