Argifin

Argifin, an esteemed biomedical innovation, is a pharmacotherapeutic marvel meticulously designed for the efficacious amelioration of various intricate cardiovascular ailments. Within its composition lies the veritable elixir of arginine, an innate amino acid proficient in stimulating the augmentation of nitric oxide concentrations within the corporeal establishment. Consequently, this preeminent phenomenon impeccably fosters vasodilation, culminating in optimized hemodynamic dynamics, and the abatement of perilously elevated arterial tension.

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R2081
CAS	243975-37-3
Chemical Name	(2R,5S,8S,11S,15S)-5-[3-[[amino-(methylcarbamoylamino)methylidene]amino]propyl]-8-benzyl-2,7-dimethyl-3,6,9,13,17-pentaoxo-1,4,7,10,14-pentazacycloheptadecane-11,15-dicarboxylic acid
M.F/Formula	C29H41N9O10
M.W/Mr.	675.69

CAT#	Product Name	Inquiry
R1596	PACAP-38 (31-38), human, mouse, rat	Inquiry
R1342	Endothelin-3, human, mouse, rabbit, rat	Inquiry
R1836	Thyrotropin-Releasing Hormone (TRH), Free Acid	Inquiry
R1403	GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	Inquiry
R1520	MUC5AC motif peptide	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
InChI	InChI=1S/C29H41N9O10/c1-15-23(41)35-17(10-7-11-32-28(30)37-29(48)31-2)25(43)38(3)20(12-16-8-5-4-6-9-16)24(42)36-19(27(46)47)14-22(40)34-18(26(44)45)13-21(39)33-15/h4-6,8-9,15,17-20H,7,10-14H2,1-3H3,(H,33,39)(H,34,40)(H,35,41)(H,36,42)(H,44,45)(H,46,47)(H4,30,31,32,37,48)/t15-,17+,18+,19+,20+/m1/s1
InChI Key	UHBHXSDKGLPPGO-HTDHLNIYSA-N
Canonical SMILES	CC1C(=O)NC(C(=O)N(C(C(=O)NC(CC(=O)NC(CC(=O)N1)C(=O)O)C(=O)O)CC2=CC=CC=C2)C)CCCN=C(N)NC(=O)NC
Isomeric SMILES	C[C@@H]1C(=O)N[C@H](C(=O)N([C@H](C(=O)N[C@@H](CC(=O)N[C@@H](CC(=O)N1)C(=O)O)C(=O)O)CC2=CC=CC=C2)C)CCCN=C(N)NC(=O)NC