Corticotropin

Corticotropin (ACTH or adrenocorticotropic hormone) is a polypeptide hormone produced and secreted by the pituitary gland. It is an important player in the hypothalamic-pituitary-adrenal axis.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: 10-101-167

CAS No:9002-60-2,12427-33-7

Synonyms/Alias:Adrendcorticotrophic hormone;ACTH;ACTH (1-39);Acthar;Adrenocorticotrophin;Adrenocorticotropic hormone;Corticotrophin;H.P. acthar gel

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C207H308N56O58S
M.W/Mr.
4541.06582
Sequence
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Labeling Target
Adrenocorticotropic hormone receptor
Application
Corticotropin is for use as a diagnostic agent in the screening of patients presumed to have adrenocortical insufficiency.
Activity
Agonist
Biological Activity
Corticotropin is a diagnostic agent used in the screening of patients presumed to have adrenocortical insufficiency.
Areas of Interest
Neurological Disease
Functions
Melanocortin receptor activity

Corticotropin, also known as adrenocorticotropic hormone (ACTH), is a polypeptide hormone produced by the anterior pituitary gland. As a pivotal component of the hypothalamic-pituitary-adrenal (HPA) axis, it plays a central role in regulating adrenal cortex function, particularly in stimulating the synthesis and release of glucocorticoids such as cortisol. Its unique amino acid sequence and peptide structure make it a subject of considerable interest in endocrinology, neurobiology, and biochemical research. The ability of corticotropin to modulate stress responses, immune function, and metabolic pathways underscores its significance in both fundamental and applied bioscience investigations.

Endocrine signaling research: ACTH serves as a key tool for dissecting the molecular mechanisms underlying pituitary-adrenal communication. Researchers employ it in vitro and in vivo to probe the regulation of steroidogenesis within adrenal cortical cells, enabling the elucidation of intracellular signaling cascades triggered by peptide-receptor interactions. By applying ACTH to adrenal tissue or cell cultures, scientists can analyze downstream effects on gene expression, second messenger systems such as cyclic AMP, and the modulation of steroidogenic enzymes. These studies are instrumental in advancing the understanding of hormonal feedback loops and endocrine homeostasis.

Stress physiology studies: As a primary effector of the stress response, corticotropin is widely utilized in experimental models to investigate the physiological and molecular adaptations to acute and chronic stressors. By administering the hormone to animal models or cultured cells, researchers can simulate stress-induced activation of the HPA axis, monitor resultant changes in glucocorticoid production, and assess systemic or tissue-specific responses. Such investigations provide valuable insights into the interplay between neuroendocrine signals and stress adaptation mechanisms, supporting research into metabolic, behavioral, and immunological outcomes.

Peptide receptor characterization: The specificity of ACTH for melanocortin 2 receptors (MC2R) on adrenal cells makes it a critical ligand in receptor binding and signaling studies. Utilizing labeled or modified forms of the peptide, scientists can characterize receptor affinity, density, and downstream signaling dynamics in various experimental systems. These assays facilitate the identification of receptor subtypes, the mapping of ligand-receptor interactions, and the evaluation of novel modulators or antagonists, contributing to a refined understanding of peptide hormone pharmacology.

Peptide synthesis and analytical standards: Due to its well-defined sequence and biological activity, corticotropin is frequently employed as a reference standard in peptide synthesis, purification, and analytical validation protocols. Laboratories use synthetic or recombinant ACTH to calibrate chromatographic and mass spectrometric methods, assess peptide purity, and optimize production workflows. Its application as a standard ensures accuracy and reproducibility in the quantification of related peptides or in the development of peptide-based assays.

Immunoassay development: The unique antigenic properties of ACTH enable its use in the generation and validation of immunoassays targeting peptide hormones. Researchers utilize it to produce specific antibodies, calibrate assay sensitivity, and establish detection protocols for quantifying endogenous or exogenous ACTH levels in biological samples. These immunoassays are essential for monitoring pituitary-adrenal function in research settings, facilitating the study of hormonal rhythms, stress responses, and endocrine disorders at the molecular level.

Source#
Synthetic
Organism
Human
References

Corticotropin-releasing factor or hormone (CRF, CRH) is part of a family of related peptides including the urotensins-I (UI), sauvagine and urocortin in vertebrates, and the diuretic peptides present in insects. Corticotropin-releasing factor (CRF), urotensin-I, urocortin and sauvagine belong to a family of related neuropeptides found throughout chordate taxa and likely stem from an ancestral peptide precursor early in metazoan ancestry. In vertebrates, current evidence suggests that CRF on one hand, and urotensin-I, urocortin and sauvagine, on the other, form paralogous lineages. Urocortin and sauvagine appear to represent tetrapod orthologues of fish urotensin-I. Sauvagine's unique structure may reflect the distinctly derived evolutionary history of the anura and the amphibia in general.

Evolution and Physiology of the Corticotropin-Releasing Factor (CRF) Family of Neuropeptides in Vertebrates

In Alzheimer's disease, unaltered numbers of CRH neurons are stimulated to produce more mRNA of CRH and may, therefore, show greater CRH turnover, whereas in depression, more neurons are recruited to produce CRH and vasopressin. Increased vasopressin production in CRH neurons increases the power of the HPA system, since vasopressin strongly potentiates the ACTH-releasing activity of CRH.

Corticotropin-Releasing Hormone mRNA Levels in the Paraventricular Nucleus of Patients With Alzheimer's Disease and Depression

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesPeptide Analysis ServicesEpitope Mapping ServicesPeptide CDMOCustom Conjugation ServicePeptide Synthesis ServicesPeptide Nucleic Acids SynthesiscGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers