Corticotropin
Corticotropin (ACTH or adrenocorticotropic hormone) is a polypeptide hormone produced and secreted by the pituitary gland. It is an important player in the hypothalamic-pituitary-adrenal axis.
Online Inquiry
| CAT# | 10-101-167 |
| CAS | 9002-60-2,12427-33-7 |
| Synonyms/Alias | Adrendcorticotrophic hormone;ACTH;ACTH (1-39);Acthar;Adrenocorticotrophin;Adrenocorticotropic hormone;Corticotrophin;H.P. acthar gel |
| M.F/Formula | C207H308N56O58S |
| M.W/Mr. | 4541.06582 |
| Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Labeling Target | Adrenocorticotropic hormone receptor |
| Application | Corticotropin is for use as a diagnostic agent in the screening of patients presumed to have adrenocortical insufficiency. |
| Activity | Agonist |
| Biological Activity | Corticotropin is a diagnostic agent used in the screening of patients presumed to have adrenocortical insufficiency. |
| Areas of Interest | Neurological Disease |
| Functions | Melanocortin receptor activity |
| Disease | West syndrome
Stevens-Johnson syndrome
Exacerbation of multiple sclerosis |
| Source# | Synthetic |
Storage | -20°C |
Organism | Human |
Write a review
Ask a question
My Review for Corticotropin
Required fields are marked with *
×
Ask a Question for Corticotropin
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
