Corticotropin

Corticotropin (ACTH or adrenocorticotropic hormone) is a polypeptide hormone produced and secreted by the pituitary gland. It is an important player in the hypothalamic-pituitary-adrenal axis.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: 10-101-167

CAS No:9002-60-2,12427-33-7

Synonyms/Alias:Adrendcorticotrophic hormone;ACTH;ACTH (1-39);Acthar;Adrenocorticotrophin;Adrenocorticotropic hormone;Corticotrophin;H.P. acthar gel

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C207H308N56O58S
M.W/Mr.
4541.06582
Sequence
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Labeling Target
Adrenocorticotropic hormone receptor
Application
Corticotropin is for use as a diagnostic agent in the screening of patients presumed to have adrenocortical insufficiency.
Activity
Agonist
Biological Activity
Corticotropin is a diagnostic agent used in the screening of patients presumed to have adrenocortical insufficiency.
Areas of Interest
Neurological Disease
Functions
Melanocortin receptor activity

Corticotropin, also known as adrenocorticotropic hormone (ACTH), is a polypeptide hormone produced and secreted by the anterior pituitary gland. As a significant regulatory molecule, corticotropin plays a pivotal role in the hypothalamic-pituitary-adrenal (HPA) axis, influencing adrenal cortex function and modulating the synthesis and release of glucocorticoids. Its structure and biological activity have made it a valuable tool in scientific research, particularly in studies related to endocrinology, neurobiology, and stress physiology. The availability of synthetic and natural forms of corticotropin enables researchers to investigate hormone signaling pathways, receptor interactions, and downstream effects with precision and reproducibility. Its unique properties facilitate a broad range of experimental applications, making corticotropin an essential component in the toolkit of molecular biology and biomedical research.

Endocrine Research: In the field of endocrine research, corticotropin serves as a critical reagent for elucidating the mechanisms underlying adrenal gland function. Researchers utilize ACTH to stimulate adrenal cells in vitro, enabling the study of steroidogenesis and the regulation of cortisol and other corticosteroids. By applying corticotropin to cell cultures or animal models, scientists can dissect the signal transduction pathways involved in adrenal hormone synthesis, investigate feedback mechanisms within the HPA axis, and assess the impact of genetic or pharmacological interventions on endocrine homeostasis. This application is fundamental for advancing knowledge about hormonal control and the physiological responses to stress.

Neurobiology and Stress Studies: ACTH is widely employed in neurobiology to model the physiological and behavioral consequences of stress. By administering corticotropin in experimental settings, researchers can mimic the activation of the HPA axis and observe the resultant neurochemical and behavioral changes. These studies are instrumental in unraveling the complex interactions between neuroendocrine signaling, emotional regulation, and cognitive functions. Furthermore, the use of corticotropin in stress paradigms aids in the identification of molecular targets and pathways implicated in stress-related disorders, providing a foundation for the development of novel therapeutic strategies.

Receptor Characterization: The characterization of melanocortin receptors, particularly MC2R, relies heavily on the use of ACTH as a selective ligand. Investigators employ corticotropin to probe receptor binding affinities, signal transduction efficacy, and receptor desensitization or internalization dynamics. These studies are crucial for understanding the specificity and diversity of melanocortin receptor subtypes, as well as their physiological roles in adrenal, neural, and immune tissues. The insights gained from receptor characterization contribute to the rational design of receptor-specific agonists or antagonists for research and potential therapeutic applications.

Pharmacological Screening: Corticotropin is an indispensable tool in pharmacological screening assays aimed at identifying modulators of the HPA axis. By incorporating ACTH into high-throughput screening protocols, researchers can evaluate the efficacy and selectivity of small molecules, peptides, or biologics that influence adrenal steroidogenesis or HPA axis regulation. This approach accelerates the discovery of compounds that may modulate stress responses, metabolic processes, or immune functions, thereby expanding the repertoire of candidates for further preclinical investigation.

Immunological Investigations: The immunomodulatory properties of corticotropin have prompted its use in studies exploring the crosstalk between neuroendocrine and immune systems. Researchers apply ACTH to immune cell cultures or animal models to assess its effects on cytokine production, leukocyte trafficking, and inflammation. Through these experiments, scientists gain a deeper understanding of the bidirectional communication between the HPA axis and immune responses, shedding light on the mechanisms that underlie immune regulation during stress or disease states. Such investigations are vital for deciphering the integrated networks that maintain physiological homeostasis and for identifying new targets for immunomodulation. The broad utility of corticotropin in these diverse research directions underscores its significance as a versatile and powerful reagent for advancing scientific discovery in the life sciences.

Source#
Synthetic
Organism
Human
References

Corticotropin-releasing factor or hormone (CRF, CRH) is part of a family of related peptides including the urotensins-I (UI), sauvagine and urocortin in vertebrates, and the diuretic peptides present in insects. Corticotropin-releasing factor (CRF), urotensin-I, urocortin and sauvagine belong to a family of related neuropeptides found throughout chordate taxa and likely stem from an ancestral peptide precursor early in metazoan ancestry. In vertebrates, current evidence suggests that CRF on one hand, and urotensin-I, urocortin and sauvagine, on the other, form paralogous lineages. Urocortin and sauvagine appear to represent tetrapod orthologues of fish urotensin-I. Sauvagine's unique structure may reflect the distinctly derived evolutionary history of the anura and the amphibia in general.

Evolution and Physiology of the Corticotropin-Releasing Factor (CRF) Family of Neuropeptides in Vertebrates

In Alzheimer's disease, unaltered numbers of CRH neurons are stimulated to produce more mRNA of CRH and may, therefore, show greater CRH turnover, whereas in depression, more neurons are recruited to produce CRH and vasopressin. Increased vasopressin production in CRH neurons increases the power of the HPA system, since vasopressin strongly potentiates the ACTH-releasing activity of CRH.

Corticotropin-Releasing Hormone mRNA Levels in the Paraventricular Nucleus of Patients With Alzheimer's Disease and Depression

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOPeptide Analysis ServicesEpitope Mapping ServicesCustom Conjugation ServicecGMP Peptide ServicePeptide Synthesis ServicesPeptide Nucleic Acids SynthesisPeptide Modification Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers