Name: Corticotropin
Brand: Creative Peptides
SKU: 10-101-167
Availability: MadeToOrder

Specification Technical Data Publications Customer reviews and Q&A

M.F/Formula	C207H308N56O58S
M.W/Mr.	4541.06582
Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Labeling Target	Adrenocorticotropic hormone receptor
Application	Corticotropin is for use as a diagnostic agent in the screening of patients presumed to have adrenocortical insufficiency.
Activity	Agonist
Biological Activity	Corticotropin is a diagnostic agent used in the screening of patients presumed to have adrenocortical insufficiency.
Areas of Interest	Neurological Disease
Functions	Melanocortin receptor activity

Source#	Synthetic
Organism	Human
References	Corticotropin-releasing factor or hormone (CRF, CRH) is part of a family of related peptides including the urotensins-I (UI), sauvagine and urocortin in vertebrates, and the diuretic peptides present in insects. Corticotropin-releasing factor (CRF), urotensin-I, urocortin and sauvagine belong to a family of related neuropeptides found throughout chordate taxa and likely stem from an ancestral peptide precursor early in metazoan ancestry. In vertebrates, current evidence suggests that CRF on one hand, and urotensin-I, urocortin and sauvagine, on the other, form paralogous lineages. Urocortin and sauvagine appear to represent tetrapod orthologues of fish urotensin-I. Sauvagine's unique structure may reflect the distinctly derived evolutionary history of the anura and the amphibia in general. Evolution and Physiology of the Corticotropin-Releasing Factor (CRF) Family of Neuropeptides in Vertebrates In Alzheimer's disease, unaltered numbers of CRH neurons are stimulated to produce more mRNA of CRH and may, therefore, show greater CRH turnover, whereas in depression, more neurons are recruited to produce CRH and vasopressin. Increased vasopressin production in CRH neurons increases the power of the HPA system, since vasopressin strongly potentiates the ACTH-releasing activity of CRH. Corticotropin-Releasing Hormone mRNA Levels in the Paraventricular Nucleus of Patients With Alzheimer's Disease and Depression

1. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes

2. Zeta-potential-changing nanoparticles conjugated with cell-penetrating peptides for enhanced transfection efficiency

3. Myotropic activity and immunolocalization of selected neuropeptides of the burying beetle Nicrophorus vespilloides (Coleoptera: Silphidae)

4. Sex differences in oxidative stress level and antioxidative enzymes expression and activity in obese pre-diabetic elderly rats treated with metformin or liraglutide

5. Crystal Structure of BamB from Pseudomonas aeruginosa and Functional Evaluation of Its Conserved Structural Features

Write a review Ask a question

Featured Recommendations

Related Screening Libraries:

Peptide Drug Gene Construction and Expression Platform Peptide Screening Services High-throughput Screening Peptide Tools AI-based Peptide Drug Discovery and Structure Analysis Platform

Related Small Molecules:

Natamycin N-acetyl semax amidate Abarelix Pergolide Mesylate Salt Brinzolamide Eptifibatide Impurity 2 N-Acetyl-Phe-Octreotide

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.

Featured Services

GLP-1 (7-36) amide Acetate

Glucagon-like peptide-1 (GLP-1) is an incretin derived from the transcription product of the proglucagon gene. The major source of GLP-1 in the body is the intestinal L cell that secretes GLP-1 as a gut hormone. Its physiological functions include promoting insulin sensitivity, decreasing food intake by increasing satiety in brain and increasing insulin secretion from the pancreas in a glucose-dependent manner.

Inquiry
Deslorelin

Deslorelin is a gonadotropin releasing hormone super-agonist (GnRH agonist) also known as an LHRH agonist. It stops the production of sex hormones (testosterone and oestrogen). It is currently approved for use in veterinary medicine and is used to induce ovulation in mares as part of the artificial insemination process. It is also used to stabilize high-risk pregnancies, mainly of livestock. Unlike other GnRH agonists, which are mainly used to inhibit luteinizing hormone and follicle-stimulating hormone by their ultimate downregulation of the pituitary gland.

Inquiry
Atosiban

Atosiban is a nonapeptide, desamino-oxytocin analogue, and a competitive vasopressin/oxytocin receptor antagonist (VOTra). Atosiban is indicated to delay imminent pre-term birth in pregnant adult women. Atosiban is useful in improving the pregnancy outcome of in vitro fertilization-embryo transfer (IVF-ET) in patients with repeated implantation failure (RIF). The pregnancy rate improved from zero to 43.7%.

Inquiry
Antide

Antide acetate (Ac-AA10-NH2) is an LHRH antagonist and represses LH and FSH release from the pituitary gland. It shows a high antiovulatory activity and releases negligible histamine.

Inquiry
Lanreotide Acetate

Lanreotide is a a synthetic cyclic octapeptide analogue of somatostatin. Lanreotide inhibits the secretion of growth hormone (GH) by binding to pituitary somatostatin receptors, and may inhibit the release of various other hormones, including thyroid stimulating hormone (TSH) and the gastroenteropancreatic hormones insulin, glucagon and gastrin.

Inquiry
Thymosin β4 Acetate

Thymosin β4 is a 43 amino acid peptide which is regarded as the main intracellular G-actin sequestering peptide. Extracellular thymosin β4 may contribute to physiological processes such as angiogenesis, wound healing and regulation of inflammation.

Inquiry
Deslorelin Acetate

Deslorelin acetate is an injectable gonadotropin releasing hormone super-agonist (GnRH agonist) also known as an LHRH agonist. It stops the production of sex hormones (testosterone and oestrogen).

Inquiry
Teriparatide Acetate

Teriparatide(recombinant human parathyroid hormone) /PTH (1-34) (human) corresponds to the N-terminal part of human parathyroid hormone, a peptide consisting of 84 amino acids.

Inquiry
Terlipressin Acetate

Terlipressin acetate is a vasopressin analogue with potent vasoactive properties. Terlipressin acetate is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin acetate exerts anti-inflammatory and anti-oxidative effects. Terlipressin acetate has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research.

Inquiry
Argipressin

Vasopressin, also known as arginine vasopressin (AVP), antidiuretic hormone (ADH), or argipressin, is a neurohypophysial hormone found in most mammals. Its two primary functions are to retain water in the body and to constrict blood vessels.

Inquiry