Corticotropin

Corticotropin (ACTH or adrenocorticotropic hormone) is a polypeptide hormone produced and secreted by the pituitary gland. It is an important player in the hypothalamic-pituitary-adrenal axis.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: 10-101-167

CAS No:9002-60-2,12427-33-7

Synonyms/Alias:Adrendcorticotrophic hormone;ACTH;ACTH (1-39);Acthar;Adrenocorticotrophin;Adrenocorticotropic hormone;Corticotrophin;H.P. acthar gel

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C207H308N56O58S
M.W/Mr.
4541.06582
Sequence
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Labeling Target
Adrenocorticotropic hormone receptor
Application
Corticotropin is for use as a diagnostic agent in the screening of patients presumed to have adrenocortical insufficiency.
Activity
Agonist
Biological Activity
Corticotropin is a diagnostic agent used in the screening of patients presumed to have adrenocortical insufficiency.
Areas of Interest
Neurological Disease
Functions
Melanocortin receptor activity
Source#
Synthetic
Organism
Human
References

Corticotropin-releasing factor or hormone (CRF, CRH) is part of a family of related peptides including the urotensins-I (UI), sauvagine and urocortin in vertebrates, and the diuretic peptides present in insects. Corticotropin-releasing factor (CRF), urotensin-I, urocortin and sauvagine belong to a family of related neuropeptides found throughout chordate taxa and likely stem from an ancestral peptide precursor early in metazoan ancestry. In vertebrates, current evidence suggests that CRF on one hand, and urotensin-I, urocortin and sauvagine, on the other, form paralogous lineages. Urocortin and sauvagine appear to represent tetrapod orthologues of fish urotensin-I. Sauvagine's unique structure may reflect the distinctly derived evolutionary history of the anura and the amphibia in general.

Evolution and Physiology of the Corticotropin-Releasing Factor (CRF) Family of Neuropeptides in Vertebrates

In Alzheimer's disease, unaltered numbers of CRH neurons are stimulated to produce more mRNA of CRH and may, therefore, show greater CRH turnover, whereas in depression, more neurons are recruited to produce CRH and vasopressin. Increased vasopressin production in CRH neurons increases the power of the HPA system, since vasopressin strongly potentiates the ACTH-releasing activity of CRH.

Corticotropin-Releasing Hormone mRNA Levels in the Paraventricular Nucleus of Patients With Alzheimer's Disease and Depression

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Nucleic Acids SynthesisPeptide Analysis ServicesPeptide CDMOEpitope Mapping ServicesPeptide Synthesis ServicesCustom Conjugation ServicePeptide Modification ServicescGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers