Crotamine

Crotonamine is a 42 amino acid peptide with 3 disulfide bonds and is a potassium channel inhibitor.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Crotamine(CAS 58740-15-1)

CAT No: R1842

CAS No:58740-15-1

Synonyms/Alias:Crotamin;Crotamine;58740-15-1;UNII-E58TBP78IH;E58TBP78IH;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C214H326N64O54S7
M.W/Mr.
4884
Sequence
One Letter Code:YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG
Three Letter Code:H-Tyr-Lys-Gln-Cys(1)-His-Lys-Lys-Gly-Gly-His-Cys(2)-Phe-Pro-Lys-Glu-Lys-Ile-Cys(3)-Leu-Pro-Pro-Ser-Ser-Asp-Phe-Gly-Lys-Met-Asp-Cys(2)-Arg-Trp-Arg-Trp-Lys-Cys(1)-Cys(3)-Lys-Lys-Gly-Ser-Gly-OH
Purity
≥ 95%
Activity
As a potassium channel inhibitor, crotamine selectively inhibits Kv1.1/KCNA1, Kv1.2/KCNA2, and Kv1.3/KCNA3 channels. Crotonamine is also a rapid cell penetration peptide (CPP), which is highly specific to actively proliferating cells. In order to enter the cell, it interacts with the chain of heparan sulfate proteoglycan (HSPG), which is then internalized by the vesicle and transported into the cell with the help of vesicle protein. Inside the cell, crotamine accumulates in lysosomal vesicles, causing them to be destroyed at high concentrations. Crotonamine shows antibacterial activity against Escherichia coli and Bacillus subtilis, as well as against Candida and Trichosporum. And Neospora. It kills bacteria through membrane permeabilization.

Crotamine is a naturally occurring peptide toxin originally isolated from the venom of the South American rattlesnake, Crotalus durissus terrificus. As a small, cationic, and cysteine-rich peptide, it exhibits a unique structural motif characterized by a compact β-defensin-like fold stabilized by multiple disulfide bonds. Its ability to interact with cellular membranes and selectively penetrate a variety of cell types has established crotamine as a significant subject of investigation in peptide biochemistry and cellular biology. The molecule's distinctive physicochemical properties and biological activities have made it a valuable tool for researchers studying peptide-membrane interactions, intracellular delivery mechanisms, and ion channel modulation.

Cell Penetrating Peptide Research: Crotamine is widely recognized for its potent cell-penetrating properties, enabling efficient translocation across cellular membranes. Researchers utilize this peptide to investigate the mechanisms underlying cellular uptake of cationic peptides, providing insights into endocytic and non-endocytic internalization pathways. Its robust internalization capabilities make it an exemplary model for studying the structure-activity relationships that govern peptide-mediated cellular entry, thereby supporting the rational design of novel delivery vectors in basic research settings.

Intracellular Delivery Studies: The capacity of crotamine to ferry macromolecules such as oligonucleotides, proteins, and small drugs into living cells has positioned it as a practical tool for developing and optimizing intracellular delivery strategies. Scientists employ the peptide as a carrier system to explore how cargoes can be efficiently transported into the cytoplasm or nucleus, facilitating studies on gene expression modulation, protein function analysis, and cellular imaging. Its effectiveness as a delivery facilitator is often benchmarked against other cell-penetrating peptides, enabling comparative analyses of delivery efficiency and specificity.

Ion Channel Modulation Research: Crotamine's interaction with voltage-gated sodium and potassium channels has made it a valuable probe for electrophysiological studies. By modulating ion channel function, the peptide aids in dissecting the molecular mechanisms of channel gating, selectivity, and pharmacological inhibition. Electrophysiologists and neurobiologists employ it to elucidate the structure-function relationships of ion channels, advancing the understanding of cellular excitability, signal transduction, and neurotoxicology.

Membrane Interaction and Structural Studies: Due to its amphipathic character and positive charge, crotamine serves as an important model for examining peptide-lipid interactions. Biophysical and structural biology laboratories use the peptide to study how cationic peptides associate with and perturb biological membranes, employing techniques such as NMR spectroscopy, circular dichroism, and fluorescence assays. These investigations contribute to a deeper understanding of membrane dynamics, peptide folding, and the determinants of membrane selectivity, informing the design of synthetic peptides with tailored membrane activity.

Peptide Engineering and Functionalization: The well-defined structure and functional versatility of crotamine make it a template for peptide engineering efforts. Researchers leverage its sequence and disulfide-rich scaffold to design novel peptide analogs with enhanced stability, altered specificity, or tailored bioactivity. Such engineering studies enable the development of new molecular tools for probing cellular processes, as well as the creation of custom peptides for use in advanced research applications, screening platforms, or as bioconjugation scaffolds. The insights gained from these approaches contribute to expanding the utility of cationic peptides in diverse areas of chemical biology and biotechnology.

Length
42
Shipping Condition
Room temperature
InChI
InChI=1S/C214H326N64O54S7/c1-6-117(4)175-209(329)274-162-113-339-335-109-158(202(322)253-136(53-22-31-76-220)184(304)248-132(49-18-27-72-216)178(298)238-103-170(287)245-154(105-279)180(300)240-104-174(294)295)273-206(326)161-112-338-336-110-159(270-190(310)142(66-68-166(225)283)255-182(302)134(51-20-29-74-218)246-176(296)128(224)87-120-62-64-125(282)65-63-120)203(323)262-149(93-124-99-231-115-242-124)196(316)251-135(52-21-30-75-219)183(303)247-131(48-17-26-71-215)177(297)237-100-167(284)236-101-168(285)244-148(92-123-98-230-114-241-123)195(315)271-160(204(324)266-153(89-119-42-11-8-12-43-119)211(331)276-82-37-59-163(276)207(327)258-138(55-24-33-78-222)185(305)256-143(67-69-171(288)289)189(309)249-139(192(312)275-175)56-25-34-79-223)111-337-334-108-157(201(321)254-141(58-36-81-233-214(228)229)187(307)261-147(91-122-97-235-130-47-16-14-45-127(122)130)194(314)252-140(57-35-80-232-213(226)227)186(306)260-146(90-121-96-234-129-46-15-13-44-126(121)129)193(313)250-137(188(308)269-161)54-23-32-77-221)272-198(318)151(95-173(292)293)263-191(311)144(70-85-333-5)257-181(301)133(50-19-28-73-217)243-169(286)102-239-179(299)145(88-118-40-9-7-10-41-118)259-197(317)150(94-172(290)291)264-199(319)155(106-280)267-200(320)156(107-281)268-208(328)164-60-38-83-277(164)212(332)165-61-39-84-278(165)210(330)152(86-116(2)3)265-205(162)325/h7-16,40-47,62-65,96-99,114-117,128,131-165,175,234-235,279-282H,6,17-39,48-61,66-95,100-113,215-224H2,1-5H3,(H2,225,283)(H,230,241)(H,231,242)(H,236,284)(H,237,297)(H,238,298)(H,239,299)(H,240,300)(H,243,286)(H,244,285)(H,245,287)(H,246,296)(H,247,303)(H,248,304)(H,249,309)(H,250,313)(H,251,316)(H,252,314)(H,253,322)(H,254,321)(H,255,302)(H,256,305)(H,257,301)(H,258,327)(H,259,317)(H,260,306)(H,261,307)(H,262,323)(H,263,311)(H,264,319)(H,265,325)(H,266,324)(H,267,320)(H,268,328)(H,269,308)(H,270,310)(H,271,315)(H,272,318)(H,273,326)(H,274,329)(H,275,312)(H,288,289)(H,290,291)(H,292,293)(H,294,295)(H4,226,227,232)(H4,228,229,233)/t117-,128-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,156-,157-,158-,159-,160-,161-,162-,163-,164-,165-,175-/m0/s1
InChI Key
PEFQQQGFYPMQLH-WFQFKEFWSA-N
Canonical SMILES
CCC(C)C1C(=O)NC2CSSCC(NC(=O)C3CSSCC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NCC(=O)NCC(=O)NC(C(=O)NC(CSSCC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)N3)CCCCN)CC4=CNC5=CC=CC=C54)CCCNC(=N)N)CC6=CNC7=CC=CC=C76)CCCNC(=N)N)NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)CNC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C8CCCN8C(=O)C9CCCN9C(=O)C(NC2=O)CC(C)C)CO)CO)CC(=O)O)CC2=CC=CC=C2)CCCCN)CCSC)CC(=O)O)C(=O)NC(C(=O)N2CCCC2C(=O)NC(C(=O)NC(C(=O)NC(C(=O)N1)CCCCN)CCC(=O)O)CCCCN)CC1=CC=CC=C1)CC1=CN=CN1)CCCCN)CCCCN)CC1=CN=CN1)NC(=O)C(CCC(=O)N)NC(=O)C(CCCCN)NC(=O)C(CC1=CC=C(C=C1)O)N)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NCC(=O)NC(CO)C(=O)NCC(=O)O
Modifications
Disulfide bond(3)

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServicePeptide Modification ServicesPeptide Nucleic Acids SynthesisPeptide CDMOEpitope Mapping ServicesPeptide Synthesis ServicescGMP Peptide ServicePeptide Analysis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers