Big Endothelin-3 (1-41) amide (human) trifluoroacetate salt

Big Endothelin-3 (1-41) amide (human) trifluoroacetate salt is a precursor peptide used to study proteolytic activation and extended disulfide-stabilized architecture. Its sequence supports modeling of folding intermediates and receptor-binding domains. Applications include peptide structure analysis and biosynthesis research.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: E09046

CAS No:133551-97-0 net

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₂₂₃H₃₂₂N₅₆O₆₃S₄
M.W/Mr.
4923.61
Sequence
One Letter Code: CTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFR-NH₂
three Letter Code: H-Cys-Thr-Cys-Phe-Thr-Tyr-Lys-Asp-Lys-Glu-Cys-Val-Tyr-Tyr-Cys-His-Leu-Asp-Ile-Ile-Trp-Ile-Asn-Thr-Pro-Glu-Gln-Thr-Val-Pro-Tyr-Gly-Leu-Ser-Asn-Tyr-Arg-Gly-Ser-Phe-Arg-NH₂ trifluoroacetate salt (Disulfide bonds between Cys¹ and Cys¹⁵/Cys³ and Cys¹¹)
Source#
Synthetic

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServicePeptide CDMOEpitope Mapping ServicescGMP Peptide ServicePeptide Analysis ServicesPeptide Modification ServicesPeptide Synthesis ServicesPeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers