Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C₂₂₃H₃₂₂N₅₆O₆₃S₄ |
M.W/Mr. | 4923.61 |
Sequence | One Letter Code: CTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFR-NH₂ three Letter Code: H-Cys-Thr-Cys-Phe-Thr-Tyr-Lys-Asp-Lys-Glu-Cys-Val-Tyr-Tyr-Cys-His-Leu-Asp-Ile-Ile-Trp-Ile-Asn-Thr-Pro-Glu-Gln-Thr-Val-Pro-Tyr-Gly-Leu-Ser-Asn-Tyr-Arg-Gly-Ser-Phe-Arg-NH₂ trifluoroacetate salt (Disulfide bonds between Cys¹ and Cys¹⁵/Cys³ and Cys¹¹) |
Source# | Synthetic |
3. Myotropic activity of allatostatins in tenebrionid beetles
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
Required fields are marked with *
×Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.