Margatoxin

A potent and specific KV1.3 channel blocker, and exhibits no effect at calcium-activated channels. Margatoxin can reduces VEGF-induced transmembrane calcium influxes and nitric oxide production in human endothelial cells.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Margatoxin(CAS 145808-47-5)

CAT No: R0995

CAS No:145808-47-5

Synonyms/Alias:Margatoxin;145808-47-5;6197NL836C;UNII-6197NL836C;potassium channel toxin alpha-KTx 2.2;MARGATOXIN [MI];DTXSID90897082;HB1083;C178H286N52O50S7;DA-75321;FM108623;H-Thr-Ile-Ile-Asn-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Leu-Pro-Pro-Cys-Lys-Ala-Gln-Phe-Gly-Gln-Ser-Ala-Gly-Ala-Lys-Cys-Met -Asn-Gly-L ys-Cys-Lys-Cys-Tyr-Pro-His-OH; H-TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH-OH;THR-ILE-ILE-ASN-VAL-LYS-CYS-THR-SER-PRO-LYS-GLN-CYS-LEU-PRO-PRO-CYS-LYS-ALA-GLN-PHE-GLY-GLN-SER-ALA-GLY-ALA-LYS-CYS-MET-ASN-GLY-LYS-CYS-LYS-CYS-TYR-PRO-HIS, CYCLIC (7->29),(13->34),(17->36)-TRIS(DISULFIDE);

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C178H286N52O50S7
M.W/Mr.
4179
Sequence
One Letter Code:TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH
Three Letter Code:H-Thr-Ile-Ile-Asn-Val-Lys-Cys(1)-Thr-Ser-Pro-Lys-Gln-Cys(2)-Leu-Pro-Pro-Cys(3)-Lys-Ala-Gln-Phe-Gly-Gln-Ser-Ala-Gly-Ala-Lys-Cys(1)-Met-Asn-Gly-Lys-Cys(2)-Lys-Cys(3)-Tyr-Pro-His-OH
Labeling Target
KV1.3 channel
Appearance
White lyophilised solid
Purity
>98%
Activity
Blocker
InChI
InChI=1S/C178H286N52O50S7/c1-15-91(7)140(225-172(273)141(92(8)16-2)224-169(270)138(190)96(12)233)171(272)211-114(75-134(189)240)158(259)223-139(90(5)6)170(271)208-107(43-25-31-64-184)153(254)221-125-87-287-283-83-121-161(262)206-111(58-69-281-14)157(258)210-113(74-133(188)239)147(248)194-78-136(242)199-102(38-20-26-59-179)149(250)217-120-82-282-284-84-122(220-156(257)110(54-57-132(187)238)205-150(251)106(42-24-30-63-183)207-166(267)126-44-33-66-228(126)176(277)119(81-232)216-173(274)142(97(13)234)226-165(125)266)163(264)212-115(70-89(3)4)174(275)230-68-35-47-129(230)177(278)229-67-34-46-128(229)168(269)222-124(86-286-285-85-123(219-152(253)105(204-160(120)261)41-23-29-62-182)164(265)213-116(72-99-48-50-101(235)51-49-99)175(276)227-65-32-45-127(227)167(268)214-117(178(279)280)73-100-76-191-88-195-100)162(263)203-103(39-21-27-60-180)148(249)198-95(11)145(246)202-109(53-56-131(186)237)155(256)209-112(71-98-36-18-17-19-37-98)146(247)193-79-137(243)200-108(52-55-130(185)236)154(255)215-118(80-231)159(260)197-93(9)143(244)192-77-135(241)196-94(10)144(245)201-104(151(252)218-121)40-22-28-61-181/h17-19,36-37,48-51,76,88-97,102-129,138-142,231-235H,15-16,20-35,38-47,52-75,77-87,179-184,190H2,1-14H3,(H2,185,236)(H2,186,237)(H2,187,238)(H2,188,239)(H2,189,240)(H,191,195)(H,192,244)(H,193,247)(H,194,248)(H,196,241)(H,197,260)(H,198,249)(H,199,242)(H,200,243)(H,201,245)(H,202,246)(H,203,263)(H,204,261)(H,205,251)(H,206,262)(H,207,267)(H,208,271)(H,209,256)(H,210,258)(H,211,272)(H,212,264)(H,213,265)(H,214,268)(H,215,255)(H,216,274)(H,217,250)(H,218,252)(H,219,253)(H,220,257)(H,221,254)(H,222,269)(H,223,259)(H,224,270)(H,225,273)(H,226,266)(H,279,280)/t91-,92-,93-,94-,95-,96+,97+,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,138-,139-,140-,141-,142-/m0/s1
InChI Key
OVJBOPBBHWOWJI-FYNXUGHNSA-N
References

When MgTx was isolated and its high affinity interaction with Kv1.3 was precisely characterized it was only tested on a limited number of channels excluding Kv1.1, Kv1.2 and Kv1.4 channels, those with high sequence homology to Kv1.3. Later the authors who described MgTx and other workgroups refer to the peptide as potent blocker of Kv1.1, Kv1.2 and Kv1.3 channels, whereas the references do not describe or contain any information about the interaction of MgTx and the Kv1.1 or Kv1.2 channels. Without the precise characterization of the selectivity profile of MgTx, results from radioactively labeled MgTx binding assays, observed potassium current block or other biological effects of the peptide may not be considered as a direct proof of Kv1.3 expression. In addition, MgTx shares high sequence homology with other scorpion peptides that block both Kv1.3 and Kv1.2 channels with high affinity (Noxiustoxin, Css20) suggesting that MgTx may be a non-selective peptide as well.

Margatoxin is a non-selective inhibitor of human Kv1.3 K+channels

Margatoxin (MgTX), a 39-amino acid peptide from Centruroides margaritatus, is a potent inhibitor of lymphocyte KV channels. The binding of monoiodotyrosinyl margatoxin ([125I]MgTX) to plasma membranes prepared from either Jurkat cells, a human leukemic T cell line, or CHO cells stably transfected with the Shaker-type voltage-gated K+ channel, KV1.3, has been used to investigate the properties of lymphocyte KVchannels. These data were compared with [125I]MgTX binding to heterotetrameric KV channels in rat brain synaptic plasma membranes.

Margatoxin Binds to a Homomultimer of KV1.3 Channels in Jurkat Cells. Comparison with KV1.3 Expressed in CHO Cells

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Nucleic Acids SynthesisEpitope Mapping ServicesPeptide CDMOCustom Conjugation ServicePeptide Synthesis ServicescGMP Peptide ServicePeptide Analysis ServicesPeptide Modification Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers