CAT# | N1951 |
CAS | 423206-00-2 |
M.F/Formula | C₃₇₉H₆₀₆N₁₁₄O₁₀₁S₁₃ |
M.W/Mr. | 8792.55 |
Sequence | One Letter Code: AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK three Letter Code: H-Ala-Val-Ile-Thr-Gly-Ala-Cys-Asp-Lys-Asp-Ser-Gln-Cys-Gly-Gly-Gly-Met-Cys-Cys-Ala-Val-Ser-Ile-Trp-Val-Lys-Ser-Ile-Arg-Ile-Cys-Thr-Pro-Met-Gly-Lys-Leu-Gly-Asp-Ser-Cys-His-Pro-Leu-Thr-Arg-Lys-Val-Pro-Phe-Phe-Gly-Arg-Arg-Met-His-His-Thr-Cys-Pro-Cys-Leu-Pro-Gly-Leu-Ala-Cys-Leu-Arg-Thr-Ser-Phe-Asn-Arg-Phe-Ile-Cys-Leu-Ala-Gln-Lys-OH trifluoroacetate salt (Disulfide bonds, air oxidized) |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
PM102 is a novel synthetic peptide that effectively reverses the anticoagulant effect of heparin. It can be used ...
UFP-803 (H-Asp-c[Pen-Phe-DTrp-Dab-Tyr-Cys]-Val-OH), [Pen 5, DTrp 7, Dab 8] U-II (4-11), is a peptidic UT (urote ...
Teicoplanin is a glycopeptide antibiotic developed after vancomycin for the treatment of Gram-positive (G+) cocc ...
Sinapultide (also known as KL4 peptide) is a synthetic protein used to mimic human SP-B. Respiratory distress ...
Obtustatin isolated from the venom of the Vipera lebetina obtusa viper is a highly potent integrin α1β1 inhibito ...