Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | AVKDTYSCFIMRGKCRHECHDFEKPIGFCTKLNANCYM |
Activity | Antibacterial |
Host Chemicals | Homo sapiens |
Length | 38 |
SwissProt ID | Q30KQ1 |
1. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
3. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
4. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.