Calcitonin

Tetracosactide is a synthetic peptide, which corresponds to the first 24 amino acids of the naturally occurring hormone ACTH (adrenocorticotropic hormone). It stimulates the adrenal cortex to produce corticosteroids, mineralocorticoids, and, to a lesser extent, androgens.

Online Inquiry

CAT#10-101-218
Chemical Structure
ExplanationCalcitonin eel is a peptide hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates.
Synonyms/AliasEel calcitonin; Calcitonin (eel); Calcitonin, Eel; Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 [Disulfide bridge: 1-7], Thyrocalcitonin Eel
M.F/FormulaC146H241N43O47S2
M.W/Mr.3414.87
SequenceOne Letter Code: CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Contact Us

Address:

Tel: |

Email:

Copyright © 2022 Creative Peptides. All rights reserved.