Calcitonin eel

Calcitonin eel is a peptide hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Calcitonin eel(CAS 57014-02-5)

CAT No: 10-101-218

CAS No:57014-02-5

Synonyms/Alias:Calcitonin (eel);Eel calcitonin;57014-02-5;Calcitonin, Eel;Eel Thyrocalcitonin;UNII-R5527T0R0U;HC 58;R5527T0R0U;MFCD00133858;G77957;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C146H241N43O47S2
M.W/Mr.
3414.9
Sequence
One Letter Code:CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP
Three Letter Code:H-Cys(1)-Ser-Asn-Leu-Ser-Thr-Cys(1)-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2

Calcitonin eel, also known as eel-derived calcitonin or salmon calcitonin, is a polypeptide hormone renowned for its potent regulatory effects on calcium and bone metabolism. Isolated from the ultimobranchial glands of eel species, this peptide exhibits a unique amino acid sequence that confers enhanced biological activity and stability compared to its mammalian counterparts. Its ability to interact with specific cellular receptors makes it a valuable tool for researchers investigating various physiological and biochemical pathways related to mineral homeostasis. The high affinity and prolonged action of eel calcitonin have positioned it as a preferred model in experimental settings, particularly when studying the modulation of osteoclastic bone resorption and the intricate signaling networks governing calcium dynamics. Its versatility in laboratory applications extends across multiple disciplines, offering researchers a robust reagent for dissecting complex biological mechanisms.

Bone Metabolism Research: Calcitonin eel serves as a critical reagent in bone biology laboratories, where it is employed to elucidate the molecular mechanisms underlying bone resorption and formation. By inhibiting osteoclast activity, this peptide enables scientists to investigate the pathways that regulate bone turnover and mineral density. Its use in in vitro models allows for the dissection of signaling cascades that control osteoblastic and osteoclastic function, providing insights into the fundamental processes that maintain skeletal integrity. The robust activity and stability of eel-derived calcitonin make it an ideal candidate for long-term studies aimed at identifying novel targets for bone health interventions.

Calcium Homeostasis Studies: Eel calcitonin is widely utilized in research focused on calcium regulation, particularly in exploring the hormone's effects on renal and intestinal calcium handling. By modulating the activity of calcium transporters and channels, it facilitates the analysis of homeostatic mechanisms that balance serum calcium concentrations. Researchers leverage its potent biological effects to model hypercalcemic and hypocalcemic conditions in animal and cellular systems, thereby advancing the understanding of endocrine control over mineral metabolism. These investigations are essential for unraveling the complex feedback loops that govern systemic calcium balance.

Endocrine Signaling Pathway Analysis: As a peptide hormone with well-characterized receptor interactions, salmon calcitonin is instrumental in mapping the downstream signaling events triggered by calcitonin receptor activation. Its application in cellular assays helps delineate the roles of cyclic AMP, protein kinase pathways, and gene expression changes subsequent to receptor engagement. This enables scientists to identify key regulatory nodes within the endocrine signaling network, offering a platform for the discovery of modulators that can influence hormone action. Such studies contribute to a broader comprehension of hormonal regulation in vertebrates and support the development of innovative research tools.

Comparative Physiology Investigations: The distinct structure and activity profile of eel-derived calcitonin make it an excellent model for comparative studies across different species. Researchers employ it to examine evolutionary variations in hormone-receptor interactions and to compare the physiological responses elicited by homologous peptides in diverse vertebrate taxa. These investigations provide valuable data on the adaptation and specialization of hormonal systems, shedding light on the evolutionary pressures that have shaped calcium regulation mechanisms in aquatic and terrestrial organisms alike.

Pharmacological Screening and Receptor Binding Assays: The high potency and receptor specificity of eel calcitonin render it a preferred ligand for pharmacological profiling and receptor binding studies. It is frequently used to assess the affinity and efficacy of novel compounds targeting the calcitonin receptor, serving as a reference standard in competitive binding assays. Additionally, its application in high-throughput screening platforms supports the identification of small molecules or peptides with potential modulatory effects on receptor function. These efforts are pivotal for advancing drug discovery and for the characterization of receptor-ligand interactions at the molecular level.

In summary, calcitonin eel stands as a versatile and indispensable tool in scientific research, with broad applications spanning bone metabolism, calcium homeostasis, endocrine signaling, comparative physiology, and pharmacological screening. Its unique properties and robust activity profile continue to drive innovation in the exploration of fundamental biological processes and the development of new experimental approaches within the fields of biochemistry, molecular biology, and physiology.

Shipping Condition
Room temperature in continental US; may vary elsewhere.
InChI
InChI=1S/C146H241N43O47S2/c1-66(2)47-88(175-140(231)112(72(13)14)184-137(228)100-64-238-237-63-81(149)119(210)178-97(60-190)135(226)174-94(54-105(152)200)132(223)172-92(51-70(9)10)130(221)180-99(62-192)136(227)187-115(76(18)195)143(234)181-100)120(211)159-58-107(202)163-82(27-20-22-42-147)121(212)169-91(50-69(7)8)129(220)179-98(61-191)134(225)167-85(36-39-103(150)198)123(214)165-87(38-41-109(204)205)124(215)171-90(49-68(5)6)128(219)173-93(53-79-56-156-65-161-79)131(222)164-83(28-21-23-43-148)122(213)170-89(48-67(3)4)127(218)166-86(37-40-104(151)199)126(217)186-114(75(17)194)142(233)177-96(52-78-32-34-80(197)35-33-78)144(235)189-46-26-31-102(189)138(229)168-84(29-24-44-157-146(154)155)125(216)185-113(74(16)193)141(232)176-95(55-110(206)207)133(224)183-111(71(11)12)139(230)160-57-106(201)162-73(15)118(209)158-59-108(203)182-116(77(19)196)145(236)188-45-25-30-101(188)117(153)208/h32-35,56,65-77,81-102,111-116,190-197H,20-31,36-55,57-64,147-149H2,1-19H3,(H2,150,198)(H2,151,199)(H2,152,200)(H2,153,208)(H,156,161)(H,158,209)(H,159,211)(H,160,230)(H,162,201)(H,163,202)(H,164,222)(H,165,214)(H,166,218)(H,167,225)(H,168,229)(H,169,212)(H,170,213)(H,171,215)(H,172,223)(H,173,219)(H,174,226)(H,175,231)(H,176,232)(H,177,233)(H,178,210)(H,179,220)(H,180,221)(H,181,234)(H,182,203)(H,183,224)(H,184,228)(H,185,216)(H,186,217)(H,187,227)(H,204,205)(H,206,207)(H4,154,155,157)/t73-,74+,75+,76+,77+,81-,82-,83-,84-,85-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,111-,112-,113-,114-,115-,116-/m0/s1
InChI Key
JDJALSWDQPEHEJ-LMVCGNDWSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicesPeptide CDMOCustom Conjugation ServicePeptide Analysis ServicesEpitope Mapping ServicescGMP Peptide ServicePeptide Modification ServicesPeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers