Calcitonin eel

Calcitonin eel is a peptide hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates.

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	10-101-218
Chemical Structure
CAS	57014-02-5
Synonyms/Alias	Eel calcitonin; Calcitonin (eel); Calcitonin, Eel; Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 [Disulfide bridge: 1-7], Thyrocalcitonin Eel
M.F/Formula	C146H241N43O47S2
M.W/Mr.	3414.87
Sequence	One Letter Code: CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP

CAT#	Product Name	Inquiry
10-101-244	[Tyr0]-C-Type Natriuretic Peptide (32-53)	Inquiry
10-101-97	Peptide YY (human) Acetate	Inquiry
10-101-219	MOTS-C	Inquiry
10-101-190	Felypressin Impurity C	Inquiry
10-101-298	(2S-cis)-(-)-5-Benzyl-3,6-dioxo-2-piperazineacetic acid	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Storage	Desiccate at -20°C
Shipping Condition	Room temperature in continental US; may vary elsewhere.