Home > Product > Antimicrobial Peptides > Cycloviolin-C

Antimicrobial Peptides

Cycloviolin-C

Price Inquiry
CAT#
AF1917
Sequence
GIPCGESCVFIPCLTTVAGCSCKNKVCYRN
Host Chemicals
Leonia cymosa
Length
30
Activity
Antiviral
SwissProt ID
P84639

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.