Exendin-4

Exendin-4 is a 39-residue peptide featuring amphipathic helices and regions that confer strong receptor-binding potential. The sequence contains structural motifs that resist enzymatic degradation and promote membrane interaction. Researchers use it to study helix formation, conformational transitions, and ligand-recognition interfaces. Its well-defined domains support broad biochemical research.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2090

CAS No:141758-74-9

Synonyms/Alias:AC 2993;AC 2993 LAR;bydureon;Byetta;Ex4 peptide;exenatide;exendatide 4;exendin-4;ITCA 650;Peptide, Ex4

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C184H282N50O60S
M.W/Mr.
4187
Sequence
One Letter Code:HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Three Letter Code:H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2

Exendin-4 is a synthetic peptide originally derived from the salivary secretion of the Gila monster, notable for its structural and functional similarity to the mammalian incretin hormone glucagon-like peptide-1 (GLP-1). As a 39-amino acid peptide, it exhibits high affinity for the GLP-1 receptor, making it a valuable tool in metabolic research and peptide-based signaling studies. Its resistance to enzymatic degradation, compared to endogenous GLP-1, further enhances its utility in experimental settings focused on glucose homeostasis, insulin secretion, and receptor pharmacology. These unique biochemical properties have established Exendin-4 as a key reagent in the exploration of peptide hormone action and receptor-ligand interactions within the broader context of endocrinology and metabolic regulation.

Receptor Pharmacology: Exendin-4 is widely employed as a selective agonist for the GLP-1 receptor in in vitro and in vivo studies. Researchers use it to dissect the molecular mechanisms underlying GLP-1 receptor activation, downstream signaling cascades, and receptor desensitization. Its high receptor specificity and stability enable detailed investigations into G protein-coupled receptor (GPCR) pharmacodynamics, supporting the characterization of receptor-ligand interactions and facilitating the development of novel peptide-based probes in receptor biology.

Metabolic Pathway Elucidation: The peptide serves as a powerful probe for unraveling the regulatory networks involved in glucose metabolism and insulin secretion. By mimicking the action of endogenous GLP-1, Exendin-4 enables researchers to study the modulation of pancreatic beta-cell function, insulinotropic effects, and glucose-stimulated insulin release. Its application in cell-based assays and animal models provides critical insights into the complex interplay between incretin hormones and metabolic homeostasis, supporting the identification of new metabolic targets and the validation of experimental hypotheses in endocrinology.

Peptide Structure-Function Analysis: Exendin-4 is frequently utilized as a model peptide for structure-activity relationship (SAR) studies within the GLP-1 family. Through systematic modification and analysis of its amino acid sequence, investigators can delineate the structural determinants responsible for receptor binding affinity, biological potency, and proteolytic stability. These studies not only advance understanding of peptide hormone architecture but also inform the rational design of next-generation peptide analogs with enhanced pharmacological profiles for research purposes.

Analytical Method Development: The unique sequence and physicochemical properties of Exendin-4 make it a valuable standard in the development and validation of analytical techniques such as high-performance liquid chromatography (HPLC), mass spectrometry, and immunoassays. Laboratories employ the peptide to calibrate detection systems, optimize assay sensitivity, and establish quantification protocols for peptide hormones and their analogs. Its well-characterized nature supports robust quality control and method standardization in peptide analytics.

Cell Signaling and Functional Assays: Exendin-4 is instrumental in functional studies aimed at elucidating intracellular signaling pathways downstream of GLP-1 receptor activation. Researchers apply the peptide in cellular models to monitor cyclic AMP (cAMP) production, protein kinase A (PKA) activation, and other second messenger systems. These assays help clarify the physiological roles of incretin signaling in diverse tissues, contributing to a more comprehensive understanding of peptide-mediated regulation in cellular physiology and metabolic research.

InChI
InChI=1S/C184H282N50O60S/c1-16-94(10)147(178(289)213-114(52-58-144(257)258)163(274)218-121(73-101-77-195-105-39-24-23-38-103(101)105)168(279)215-116(68-90(2)3)165(276)205-107(41-26-28-61-186)158(269)219-122(75-134(189)243)154(265)198-79-135(244)196-83-139(248)231-63-30-43-129(231)175(286)225-127(87-238)174(285)223-125(85-236)155(266)200-80-136(245)202-96(12)181(292)233-65-32-45-131(233)183(294)234-66-33-46-132(234)182(293)232-64-31-44-130(232)176(287)222-124(84-235)150(190)261)229-170(281)119(71-99-34-19-17-20-35-99)217-166(277)117(69-91(4)5)214-159(270)108(42-29-62-194-184(191)192)212-177(288)146(93(8)9)228-151(262)95(11)203-156(267)111(49-55-141(251)252)208-161(272)112(50-56-142(253)254)209-162(273)113(51-57-143(255)256)210-164(275)115(59-67-295-15)211-160(271)110(47-53-133(188)242)207-157(268)106(40-25-27-60-185)206-172(283)126(86-237)224-167(278)118(70-92(6)7)216-169(280)123(76-145(259)260)220-173(284)128(88-239)226-180(291)149(98(14)241)230-171(282)120(72-100-36-21-18-22-37-100)221-179(290)148(97(13)240)227-138(247)82-199-153(264)109(48-54-140(249)250)204-137(246)81-197-152(263)104(187)74-102-78-193-89-201-102/h17-24,34-39,77-78,89-98,104,106-132,146-149,195,235-241H,16,25-33,40-76,79-88,185-187H2,1-15H3,(H2,188,242)(H2,189,243)(H2,190,261)(H,193,201)(H,196,244)(H,197,263)(H,198,265)(H,199,264)(H,200,266)(H,202,245)(H,203,267)(H,204,246)(H,205,276)(H,206,283)(H,207,268)(H,208,272)(H,209,273)(H,210,275)(H,211,271)(H,212,288)(H,213,289)(H,214,270)(H,215,279)(H,216,280)(H,217,277)(H,218,274)(H,219,269)(H,220,284)(H,221,290)(H,222,287)(H,223,285)(H,224,278)(H,225,286)(H,226,291)(H,227,247)(H,228,262)(H,229,281)(H,230,282)(H,249,250)(H,251,252)(H,253,254)(H,255,256)(H,257,258)(H,259,260)(H4,191,192,194)/t94-,95-,96-,97+,98+,104-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,146-,147-,148-,149-/m0/s1
InChI Key
HTQBXNHDCUEHJF-XWLPCZSASA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServicePeptide Synthesis ServicesPeptide Analysis ServicesPeptide Modification ServicesPeptide Nucleic Acids SynthesisPeptide CDMOcGMP Peptide ServiceEpitope Mapping Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers