Tel: 1-631-624-4882
Email: info@creative-peptides.com

GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(biotinyl)-NH2 trifluoroacetate salt

Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(biotinyl)-NH2 trifluoroacetate salt(CAS 1802086-70-9)

CAT No: G16036

CAS No: 1802086-70-9

Synonyms/Alias: 1802086-70-9;GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(biotinyl)-NH2 trifluoroacetate salt;

Quick InquiryCustom Peptide Synthesis

Peptide Library Construction and Screening

Powerful screening tools in biological and chemical research

M.F/FormulaC165H252N44O48S
M.W/Mr.3652.1
SequenceOne Letter Code:HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRX
Three Letter Code:H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(biotinyl)(biotinyl)-NH2
InChIInChI=1S/C165H252N44O48S/c1-17-85(10)132(161(254)184-89(14)140(233)193-114(68-95-71-176-100-40-25-24-39-98(95)100)151(244)195-110(64-82(4)5)152(245)205-130(83(6)7)159(252)192-102(42-28-31-59-166)142(235)177-73-123(218)185-103(44-34-62-175-164(171)172)146(239)187-101(136(170)229)41-30-33-61-174-122(217)46-27-26-45-120-135-119(79-258-120)203-165(257)209-135)207-153(246)112(65-92-35-20-18-21-36-92)196-148(241)108(54-58-128(225)226)191-147(240)104(43-29-32-60-167)188-138(231)87(12)181-137(230)86(11)183-145(238)107(51-55-121(169)216)186-124(219)74-178-144(237)106(53-57-127(223)224)190-149(242)109(63-81(2)3)194-150(243)111(67-94-47-49-97(215)50-48-94)197-156(249)116(76-210)200-158(251)118(78-212)201-160(253)131(84(8)9)206-155(248)115(70-129(227)228)198-157(250)117(77-211)202-163(256)134(91(16)214)208-154(247)113(66-93-37-22-19-23-38-93)199-162(255)133(90(15)213)204-125(220)75-179-143(236)105(52-56-126(221)222)189-139(232)88(13)182-141(234)99(168)69-96-72-173-80-180-96/h18-25,35-40,47-50,71-72,80-91,99,101-120,130-135,176,210-215H,17,26-34,41-46,51-70,73-79,166-168H2,1-16H3,(H2,169,216)(H2,170,229)(H,173,180)(H,174,217)(H,177,235)(H,178,237)(H,179,236)(H,181,230)(H,182,234)(H,183,238)(H,184,254)(H,185,218)(H,186,219)(H,187,239)(H,188,231)(H,189,232)(H,190,242)(H,191,240)(H,192,252)(H,193,233)(H,194,243)(H,195,244)(H,196,241)(H,197,249)(H,198,250)(H,199,255)(H,200,251)(H,201,253)(H,202,256)(H,204,220)(H,205,245)(H,206,248)(H,207,246)(H,208,247)(H,221,222)(H,223,224)(H,225,226)(H,227,228)(H4,171,172,175)(H2,203,209,257)/t85-,86-,87-,88-,89-,90+,91+,99-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,130-,131-,132-,133-,134-,135-/m0/s1
InChI KeyDVZRWUQLVWOAPV-PSQNHTQXSA-N
Write a review Ask a question
My Review for GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(biotinyl)-NH2 trifluoroacetate salt

Required fields are marked with *

  • Basic Information
×
Ask a Question for GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(biotinyl)-NH2 trifluoroacetate salt

Required fields are marked with *

  • Basic Information
×
Featured Recommendations
Related Screening Libraries:
Related Small Molecules:
Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.

Featured Services
Hot Products
  • Antide

    Antide acetate (Ac-AA10-NH2) is an LHRH antagonist and represses LH and FSH release from the pituitary gland. It shows a high antiovulatory activity and releases negligible histamine.

    Inquiry
  • Gonadorelin Acetate

    Gonadorelin is a trophic peptide hormone responsible for the release of follicle-stimulating hormone (FSH) and luteinizing hormone (LH) from the anterior pituitary. GnRH is synthesized and released from GnRH neurons within the hypothalamus. The peptide belongs to gonadotropin-releasing hormone family. It constitutes the initial step in the hypothalamic–pituitary–gonadal axis.

    Inquiry
  • Teduglutide

    Teduglutide is a polypeptide consisting of 33 amino acids. It is glucagon-like peptide-2 (GLP-2) analogue that is used for the treatment of short bowel syndrome.

    Inquiry
  • GLP-1 (7-37) Acetate

    Glucagon-like peptide-1 (GLP-1) is an incretin derived from the transcription product of the proglucagon gene. The major source of GLP-1 in the body is the intestinal L cell that secretes GLP-2 as a gut hormone.

    Inquiry
  • Elcatonin Acetate

    Elcatonin acetate inhibits the absorption and autolysis of bones, thus leads to blood calcium descending. In addition, it inhibits the bone salts dissolving and transferring and promotes the excretion of calcium and phosphorus in urine.

    Inquiry
  • Carperitide

    Atrial Natriuretic Peptide (ANP) (1-28), human, porcine is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. ANP (1-28) inhibits endothelin-1 secretion in a dose-dependent way.

    Inquiry
  • Deslorelin

    Deslorelin is a gonadotropin releasing hormone super-agonist (GnRH agonist) also known as an LHRH agonist. It stops the production of sex hormones (testosterone and oestrogen). It is currently approved for use in veterinary medicine and is used to induce ovulation in mares as part of the artificial insemination process. It is also used to stabilize high-risk pregnancies, mainly of livestock. Unlike other GnRH agonists, which are mainly used to inhibit luteinizing hormone and follicle-stimulating hormone by their ultimate downregulation of the pituitary gland.

    Inquiry
  • Glucagon

    Glucagon (Porcine glucagon) is a peptide hormone, produced by pancreatic α-cells. Glucagon stimulates gluconeogenesis. Glucagon decreases the activity of HNF-4. Glucagon increases HNF4α phosphorylation.

    Inquiry
  • Angiotensin II

    Angiotensin II human (Angiotensin II) is a vasoconstrictor that mainly acts on the AT1 receptor. Angiotensin II human stimulates sympathetic nervous stimulation, increases aldosterone biosynthesis and renal actions. Angiotensin II human induces growth of vascular smooth muscle cells, increases collagen type I and III synthesis in fibroblasts, leading to thickening of the vascular wall and myocardium, and fibrosis. Angiotensin II human also induces apoptosis.

    Inquiry
  • Terlipressin Acetate

    Terlipressin acetate is a vasopressin analogue with potent vasoactive properties. Terlipressin acetate is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin acetate exerts anti-inflammatory and anti-oxidative effects. Terlipressin acetate has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research.

    Inquiry
Get in touch with us

USA

Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA

Tel: 1-631-624-4882

Fax: 1-631-614-7828

Email: info@creative-peptides.com

 

Germany

Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main

Email: info@creative-peptides.com

Copyright © 2025 Creative Peptides. All rights reserved.