1. Home
  2. Research Areas
  3. Peptides in Diabetes
  4. Glucagons and Glucagon-Like Peptides (GLP-1 / GLP-2)
  5. GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(biotinyl)-NH2 trifluoroacetate salt

GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(biotinyl)-NH2 trifluoroacetate salt

GLP-1 (7-36)-Lys(biotinyl) amide trifluoroacetate salt contains a biotinylated lysine enabling affinity purification and detection. The conserved GLP-1 backbone supports receptor-binding studies across multiple species. Researchers use it to visualize ligand interactions and examine conformational changes. Its biotin tag allows sensitive tracking in immobilization and pull-down assays.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(biotinyl)-NH2 trifluoroacetate salt(CAS 1802086-70-9)

CAT No: G16036

CAS No:1802086-70-9

Synonyms/Alias:1802086-70-9;GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(biotinyl)-NH2 trifluoroacetate salt;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C165H252N44O48S
M.W/Mr.
3652.1
Sequence
One Letter Code:HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRX
Three Letter Code:H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Lys(biotinyl)(biotinyl)-NH2
InChI
InChI=1S/C165H252N44O48S/c1-17-85(10)132(161(254)184-89(14)140(233)193-114(68-95-71-176-100-40-25-24-39-98(95)100)151(244)195-110(64-82(4)5)152(245)205-130(83(6)7)159(252)192-102(42-28-31-59-166)142(235)177-73-123(218)185-103(44-34-62-175-164(171)172)146(239)187-101(136(170)229)41-30-33-61-174-122(217)46-27-26-45-120-135-119(79-258-120)203-165(257)209-135)207-153(246)112(65-92-35-20-18-21-36-92)196-148(241)108(54-58-128(225)226)191-147(240)104(43-29-32-60-167)188-138(231)87(12)181-137(230)86(11)183-145(238)107(51-55-121(169)216)186-124(219)74-178-144(237)106(53-57-127(223)224)190-149(242)109(63-81(2)3)194-150(243)111(67-94-47-49-97(215)50-48-94)197-156(249)116(76-210)200-158(251)118(78-212)201-160(253)131(84(8)9)206-155(248)115(70-129(227)228)198-157(250)117(77-211)202-163(256)134(91(16)214)208-154(247)113(66-93-37-22-19-23-38-93)199-162(255)133(90(15)213)204-125(220)75-179-143(236)105(52-56-126(221)222)189-139(232)88(13)182-141(234)99(168)69-96-72-173-80-180-96/h18-25,35-40,47-50,71-72,80-91,99,101-120,130-135,176,210-215H,17,26-34,41-46,51-70,73-79,166-168H2,1-16H3,(H2,169,216)(H2,170,229)(H,173,180)(H,174,217)(H,177,235)(H,178,237)(H,179,236)(H,181,230)(H,182,234)(H,183,238)(H,184,254)(H,185,218)(H,186,219)(H,187,239)(H,188,231)(H,189,232)(H,190,242)(H,191,240)(H,192,252)(H,193,233)(H,194,243)(H,195,244)(H,196,241)(H,197,249)(H,198,250)(H,199,255)(H,200,251)(H,201,253)(H,202,256)(H,204,220)(H,205,245)(H,206,248)(H,207,246)(H,208,247)(H,221,222)(H,223,224)(H,225,226)(H,227,228)(H4,171,172,175)(H2,203,209,257)/t85-,86-,87-,88-,89-,90+,91+,99-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,130-,131-,132-,133-,134-,135-/m0/s1
InChI Key
DVZRWUQLVWOAPV-PSQNHTQXSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesPeptide Analysis ServicesPeptide Synthesis ServicescGMP Peptide ServiceCustom Conjugation ServicePeptide CDMOPeptide Nucleic Acids SynthesisEpitope Mapping Services
Hot Products
Buserelin Acetate

Buserelin Acetate is a GnRH agonist peptide regulating reproductive hormones. Buy Buserelin peptide powder online to explore fertility and hormone-dependent tumor research.

Read More Read More
Terlipressin

Terlipressin is a synthetic vasopressin analog that supports vascular and renal research. Purchase Terlipressin peptide from a verified supplier for liver and hemodynamic studies.

Read More Read More
Glucagon

Glucagon peptide promotes glycogen breakdown and blood sugar regulation. Buy Glucagon research peptide online for metabolic and liver studies.

Read More Read More
Terlipressin Acetate

Terlipressin Acetate is a synthetic vasopressin analog peptide used for vascular and liver research. Buy Terlipressin peptide powder online from a trusted peptide supplier for professional studies.

Read More Read More
Fertirelin Acetate

Fertirelin Acetate is a synthetic peptide that promotes ovulation and fertility. Purchase Fertirelin research peptide for breeding and hormonal studies.

Read More Read More
Lanreotide Acetate

Lanreotide Acetate is a somatostatin analog peptide regulating hormone secretion. Purchase Lanreotide peptide online to study tumor suppression and endocrine disorders.

Read More Read More
Teriparatide Acetate

Teriparatide Acetate is a bone-forming peptide supporting osteoporosis research. Buy Teriparatide peptide online to study bone growth and calcium metabolism.

Read More Read More
Thymosin β4 Acetate

Thymosin β4 Acetate promotes wound healing, tissue repair, and cell regeneration. Buy Thymosin beta 4 peptide powder for research on recovery and regenerative medicine.

Read More Read More
GLP-1 (7-37) Acetate

GLP-1 (7-37) Acetate is a synthetic peptide for appetite and insulin regulation. Order GLP-1 peptide powder from a trusted supplier for metabolic research.

Read More Read More
Angiotensin II

Angiotensin II peptide regulates blood pressure and vascular constriction. Purchase this synthetic research peptide to support cardiovascular and renal function studies.

Read More Read More
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers