1. Home
  2. Products
  3. Therapeutic Peptides
  4. Peptide Inhibitors
  5. H-Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH

H-Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH

H-Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH is a long, multi-domain peptide containing aromatic, hydrophobic, acidic, and basic residues. Researchers explore its hydrogen-bond networks, conformational transitions, and solvent behavior. The extended chain supports studies of modular folding and binding interactions. Applications include structural-biophysics research, motif-function mapping, and peptide engineering.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
H-Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH(CAS 299898-52-5)

CAT No: R2540

CAS No:299898-52-5

Synonyms/Alias:FP110167;(Pro3)-Gastric Inhibitory Polypeptide (human) trifluoroacetate salt;299898-52-5;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C226H338N60O64S
M.W/Mr.
4952
Sequence
One Letter Code:YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Three Letter Code:H-Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH
InChI
InChI=1S/C226H338N60O64S/c1-21-114(11)181(284-216(339)165(108-288)277-201(324)150(89-126-62-66-132(292)67-63-126)263-210(333)163(100-179(308)309)273-215(338)164(107-287)278-221(344)183(116(13)23-3)282-213(336)152(88-124-48-29-26-30-49-124)274-223(346)185(121(18)289)279-175(301)106-245-217(340)166-59-45-82-286(166)225(348)120(17)250-189(312)135(232)86-125-60-64-131(291)65-61-125)219(342)249-119(16)188(311)253-146(76-83-351-20)197(320)271-160(97-176(302)303)208(331)257-142(58-39-44-81-231)198(321)281-182(115(12)22-2)220(343)275-156(93-130-104-241-110-247-130)204(327)259-144(69-73-168(234)294)195(318)258-145(70-74-169(235)295)196(319)270-161(98-177(304)305)209(332)264-151(87-123-46-27-25-28-47-123)212(335)280-180(113(9)10)218(341)276-158(95-172(238)298)207(330)265-154(91-128-102-243-137-53-34-32-51-134(128)137)203(326)262-149(85-112(7)8)200(323)261-148(84-111(5)6)199(322)248-118(15)187(310)252-143(68-72-167(233)293)194(317)254-138(54-35-40-77-227)190(313)244-105-174(300)251-139(55-36-41-78-228)191(314)255-140(56-37-42-79-229)193(316)268-157(94-171(237)297)206(329)272-162(99-178(306)307)211(334)266-153(90-127-101-242-136-52-33-31-50-133(127)136)202(325)256-141(57-38-43-80-230)192(315)267-155(92-129-103-240-109-246-129)205(328)269-159(96-173(239)299)214(337)283-184(117(14)24-4)222(345)285-186(122(19)290)224(347)260-147(226(349)350)71-75-170(236)296/h25-34,46-53,60-67,101-104,109-122,135,138-166,180-186,242-243,287-292H,21-24,35-45,54-59,68-100,105-108,227-232H2,1-20H3,(H2,233,293)(H2,234,294)(H2,235,295)(H2,236,296)(H2,237,297)(H2,238,298)(H2,239,299)(H,240,246)(H,241,247)(H,244,313)(H,245,340)(H,248,322)(H,249,342)(H,250,312)(H,251,300)(H,252,310)(H,253,311)(H,254,317)(H,255,314)(H,256,325)(H,257,331)(H,258,318)(H,259,327)(H,260,347)(H,261,323)(H,262,326)(H,263,333)(H,264,332)(H,265,330)(H,266,334)(H,267,315)(H,268,316)(H,269,328)(H,270,319)(H,271,320)(H,272,329)(H,273,338)(H,274,346)(H,275,343)(H,276,341)(H,277,324)(H,278,344)(H,279,301)(H,280,335)(H,281,321)(H,282,336)(H,283,337)(H,284,339)(H,285,345)(H,302,303)(H,304,305)(H,306,307)(H,308,309)(H,349,350)/t114-,115-,116-,117-,118-,119-,120-,121+,122+,135-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,156-,157-,158-,159-,160-,161-,162-,163-,164-,165-,166-,180-,181-,182-,183-,184-,185-,186-/m0/s1
InChI Key
FYUWJDFZJSKUGR-STMGAEMMSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOPeptide Analysis ServicesPeptide Synthesis ServicesPeptide Nucleic Acids SynthesisEpitope Mapping ServicescGMP Peptide ServicePeptide Modification ServicesCustom Conjugation Service
Hot Products
DOTA-cyclo(RGDfK) acetate

DOTA-cyclo(RGDfK) acetate is a metal-chelating cyclic RGD peptide used to investigate integrin-binding motifs. Its cyclized structure stabilizes ligand presentation for receptor-targeting studies. Researchers analyze its conformation for high-affinity binding models. The DOTA moiety supports imaging-related biochemical experiments.

Read More Read More
Gonadorelin Acetate

Gonadorelin Acetate stimulates LH and FSH release in fertility research. Purchase Gonadorelin peptide powder from a verified peptide supplier for reproductive studies.

Read More Read More
Angiotensin II Acetate

Angiotensin II Acetate is a potent research peptide regulating blood pressure and vascular tone. Purchase this synthetic peptide to support cardiovascular and renal studies.

Read More Read More
Icatibant

Icatibant is a potent bradykinin B2 receptor antagonist peptide for inflammation and allergy research. Buy Icatibant peptide from a reliable peptide supplier to support biomedical studies.

Read More Read More
Buserelin Acetate

Buserelin Acetate is a GnRH agonist peptide regulating reproductive hormones. Buy Buserelin peptide powder online to explore fertility and hormone-dependent tumor research.

Read More Read More
Thymopentin Acetate

Thymopentin Acetate peptide enhances immune modulation and T-cell function. Purchase Thymopentin research peptide online for immunotherapy and cell biology research.

Read More Read More
Terlipressin Acetate

Terlipressin Acetate is a synthetic vasopressin analog peptide used for vascular and liver research. Buy Terlipressin peptide powder online from a trusted peptide supplier for professional studies.

Read More Read More
Terlipressin

Terlipressin is a synthetic vasopressin analog that supports vascular and renal research. Purchase Terlipressin peptide from a verified supplier for liver and hemodynamic studies.

Read More Read More
Somatostatin

Somatostatin peptide inhibits the secretion of growth hormone and insulin. Purchase high-purity Somatostatin for metabolic, neuroendocrine, and cancer research.

Read More Read More
Thymosin β4 Acetate

Thymosin β4 Acetate promotes wound healing, tissue repair, and cell regeneration. Buy Thymosin beta 4 peptide powder for research on recovery and regenerative medicine.

Read More Read More
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers