Neuropeptide Y(29-64)

Neuropeptide Y(29-64) is a 36 amino acid peptide, a fragment of Neuropeptide Y.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Neuropeptide Y(29-64)(CAS 303052-45-1)

CAT No: R1548

CAS No:303052-45-1

Synonyms/Alias:Neuropeptide Y(29-64);303052-45-1;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C189H284N54O58S
M.W/Mr.
4273
Sequence
One Letter Code:YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Three Letter Code:H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-OH

Neuropeptide Y(29-64) is a peptide fragment derived from the C-terminal region of the full-length Neuropeptide Y (NPY), a highly conserved 36-amino-acid neurotransmitter found throughout the central and peripheral nervous systems. Characterized by its partial sequence, this peptide segment retains biologically relevant features of the parent molecule, making it a valuable research tool for dissecting the structure-function relationships within the NPY family. The unique sequence of Neuropeptide Y(29-64) enables researchers to focus on the functional domains responsible for receptor binding, signal transduction, and physiological activity, thereby facilitating targeted studies in neurobiology, endocrinology, and peptide-receptor pharmacology.

Receptor Interaction Studies: Neuropeptide Y(29-64) is extensively utilized in investigations aimed at mapping the binding sites and activation mechanisms of NPY receptors, particularly the Y1 and Y2 subtypes. By employing this peptide fragment in receptor-ligand binding assays, researchers can delineate the minimal structural elements required for high-affinity interaction and receptor specificity. Such studies are instrumental in elucidating the molecular determinants of NPY-mediated signaling, contributing to a more nuanced understanding of neuropeptide-receptor dynamics and the development of selective receptor modulators.

Structure-Activity Relationship Analysis: The truncated sequence of this peptide allows for detailed structure-activity relationship (SAR) studies, wherein modifications to specific amino acid residues within the 29-64 region can be systematically evaluated for their impact on biological function. These investigations provide critical insights into the conformational requirements for receptor engagement and downstream signaling efficacy. SAR data derived from Neuropeptide Y(29-64) analogs inform the rational design of novel peptide mimetics with tailored pharmacological profiles for basic and applied research.

Neurobiological Pathway Elucidation: As a functional analog of the C-terminal domain of NPY, this peptide fragment is employed to probe the physiological roles of endogenous neuropeptides in neural circuits. By selectively activating or blocking NPY-responsive pathways in ex vivo brain slice preparations or in vitro neuronal cultures, researchers can dissect the contribution of specific peptide domains to processes such as synaptic transmission, neuroendocrine regulation, and stress response. These studies enhance our understanding of how discrete neuropeptide segments influence complex neurobiological phenomena.

Peptide-Receptor Pharmacology: In pharmacological profiling, Neuropeptide Y(29-64) serves as a reference ligand or competitive antagonist in assays designed to characterize the selectivity and potency of small molecules or biologics targeting NPY receptors. Its defined sequence and receptor affinity make it an indispensable standard for benchmarking the activity of novel compounds in high-throughput screening platforms. Such applications are critical for advancing drug discovery programs focused on modulating peptide-receptor interactions in various physiological contexts.

Analytical Method Development: The well-defined structure of Neuropeptide Y(29-64) also supports its use as a calibration standard or positive control in analytical techniques such as high-performance liquid chromatography (HPLC), mass spectrometry, and immunoassays. By providing a consistent and reproducible peptide reference, it facilitates the validation of quantitative and qualitative methods for neuropeptide detection and characterization. This application is particularly valuable in quality control, biomarker research, and the development of robust analytical workflows for peptide-based studies.

Long-term Storage Conditions
Water
Shipping Condition
Room temperature in continental US; may vary elsewhere.
InChI
InChI=1S/C189H284N54O58S/c1-15-93(7)148(178(293)232-127(81-140(193)253)167(282)224-122(74-92(5)6)170(285)238-149(94(8)16-2)179(294)239-150(99(13)246)180(295)221-115(31-22-67-207-189(201)202)155(270)219-117(56-59-139(192)252)160(275)217-114(30-21-66-206-188(199)200)158(273)234-132(185(300)301)79-104-44-54-110(251)55-45-104)237-171(286)125(78-103-42-52-109(250)53-43-103)227-166(281)126(80-105-86-203-90-209-105)228-157(272)113(29-20-65-205-187(197)198)218-163(278)121(73-91(3)4)223-153(268)96(10)211-172(287)133(88-244)235-165(280)124(77-102-40-50-108(249)51-41-102)226-164(279)123(76-101-38-48-107(248)49-39-101)225-156(271)112(28-19-64-204-186(195)196)215-151(266)95(9)210-154(269)119(62-72-302-14)220-168(283)129(84-146(262)263)230-161(276)118(58-61-144(258)259)216-152(267)97(11)212-175(290)136-33-24-68-240(136)181(296)98(12)213-162(277)128(83-145(260)261)229-159(274)116(57-60-143(256)257)214-142(255)87-208-174(289)135-32-23-70-242(135)184(299)131(82-141(194)254)233-169(284)130(85-147(264)265)231-176(291)138-35-26-71-243(138)183(298)120(27-17-18-63-190)222-173(288)134(89-245)236-177(292)137-34-25-69-241(137)182(297)111(191)75-100-36-46-106(247)47-37-100/h36-55,86,90-99,111-138,148-150,244-251H,15-35,56-85,87-89,190-191H2,1-14H3,(H2,192,252)(H2,193,253)(H2,194,254)(H,203,209)(H,208,289)(H,210,269)(H,211,287)(H,212,290)(H,213,277)(H,214,255)(H,215,266)(H,216,267)(H,217,275)(H,218,278)(H,219,270)(H,220,283)(H,221,295)(H,222,288)(H,223,268)(H,224,282)(H,225,271)(H,226,279)(H,227,281)(H,228,272)(H,229,274)(H,230,276)(H,231,291)(H,232,293)(H,233,284)(H,234,273)(H,235,280)(H,236,292)(H,237,286)(H,238,285)(H,239,294)(H,256,257)(H,258,259)(H,260,261)(H,262,263)(H,264,265)(H,300,301)(H4,195,196,204)(H4,197,198,205)(H4,199,200,206)(H4,201,202,207)/t93-,94-,95-,96-,97-,98-,99+,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,148-,149-,150-/m0/s1
InChI Key
YAJRGCSGUHVGLW-HRPSIEBRSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicesPeptide Modification ServicescGMP Peptide ServicePeptide Analysis ServicesEpitope Mapping ServicesPeptide Nucleic Acids SynthesisCustom Conjugation ServicePeptide CDMO
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers