Tel: 1-631-624-4882
Email: info@creative-peptides.com

Neuropeptide Y(29-64)

Neuropeptide Y(29-64) is a 36 amino acid peptide, a fragment of Neuropeptide Y.

Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Neuropeptide Y(29-64)(CAS 303052-45-1)

CAT No: R1548

CAS No: 303052-45-1

Synonyms/Alias: Neuropeptide Y(29-64);303052-45-1;

Quick InquiryCustom Peptide Synthesis

Peptide Library Construction and Screening

Powerful screening tools in biological and chemical research

M.F/FormulaC189H284N54O58S
M.W/Mr.4273
SequenceOne Letter Code:YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Three Letter Code:H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-OH
Long-term Storage ConditionsWater
Shipping ConditionRoom temperature in continental US; may vary elsewhere.
InChIInChI=1S/C189H284N54O58S/c1-15-93(7)148(178(293)232-127(81-140(193)253)167(282)224-122(74-92(5)6)170(285)238-149(94(8)16-2)179(294)239-150(99(13)246)180(295)221-115(31-22-67-207-189(201)202)155(270)219-117(56-59-139(192)252)160(275)217-114(30-21-66-206-188(199)200)158(273)234-132(185(300)301)79-104-44-54-110(251)55-45-104)237-171(286)125(78-103-42-52-109(250)53-43-103)227-166(281)126(80-105-86-203-90-209-105)228-157(272)113(29-20-65-205-187(197)198)218-163(278)121(73-91(3)4)223-153(268)96(10)211-172(287)133(88-244)235-165(280)124(77-102-40-50-108(249)51-41-102)226-164(279)123(76-101-38-48-107(248)49-39-101)225-156(271)112(28-19-64-204-186(195)196)215-151(266)95(9)210-154(269)119(62-72-302-14)220-168(283)129(84-146(262)263)230-161(276)118(58-61-144(258)259)216-152(267)97(11)212-175(290)136-33-24-68-240(136)181(296)98(12)213-162(277)128(83-145(260)261)229-159(274)116(57-60-143(256)257)214-142(255)87-208-174(289)135-32-23-70-242(135)184(299)131(82-141(194)254)233-169(284)130(85-147(264)265)231-176(291)138-35-26-71-243(138)183(298)120(27-17-18-63-190)222-173(288)134(89-245)236-177(292)137-34-25-69-241(137)182(297)111(191)75-100-36-46-106(247)47-37-100/h36-55,86,90-99,111-138,148-150,244-251H,15-35,56-85,87-89,190-191H2,1-14H3,(H2,192,252)(H2,193,253)(H2,194,254)(H,203,209)(H,208,289)(H,210,269)(H,211,287)(H,212,290)(H,213,277)(H,214,255)(H,215,266)(H,216,267)(H,217,275)(H,218,278)(H,219,270)(H,220,283)(H,221,295)(H,222,288)(H,223,268)(H,224,282)(H,225,271)(H,226,279)(H,227,281)(H,228,272)(H,229,274)(H,230,276)(H,231,291)(H,232,293)(H,233,284)(H,234,273)(H,235,280)(H,236,292)(H,237,286)(H,238,285)(H,239,294)(H,256,257)(H,258,259)(H,260,261)(H,262,263)(H,264,265)(H,300,301)(H4,195,196,204)(H4,197,198,205)(H4,199,200,206)(H4,201,202,207)/t93-,94-,95-,96-,97-,98-,99+,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,148-,149-,150-/m0/s1
InChI KeyYAJRGCSGUHVGLW-HRPSIEBRSA-N
Write a review Ask a question
My Review for Neuropeptide Y(29-64)

Required fields are marked with *

  • Basic Information
×
Ask a Question for Neuropeptide Y(29-64)

Required fields are marked with *

  • Basic Information
×
Featured Recommendations
Related Screening Libraries:
Related Small Molecules:
Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.

Featured Services
Hot Products
  • Lanreotide Acetate

    Lanreotide is a a synthetic cyclic octapeptide analogue of somatostatin. Lanreotide inhibits the secretion of growth hormone (GH) by binding to pituitary somatostatin receptors, and may inhibit the release of various other hormones, including thyroid stimulating hormone (TSH) and the gastroenteropancreatic hormones insulin, glucagon and gastrin.

    Inquiry
  • Alarelin acetate

    Alarelin acetate is a synthetic LH-RH agonist, and stimulates the release of FSH and LH from the pituitary gland. It is known for its induction of ovulation and used to treat endmometriosis.

    Inquiry
  • Icatibant

    Icatibant (Firazyr) is a synthetic peptidomimetic drug consisting of ten amino acids, and acts as an effective and specific antagonist of bradykinin B2 receptors. It has been approved in the EU for use in hereditary angioedema, and is under investigation for a number of other conditions in which bradykinin is thought to play a significant role.

    Inquiry
  • Atosiban

    Atosiban is a nonapeptide, desamino-oxytocin analogue, and a competitive vasopressin/oxytocin receptor antagonist (VOTra). Atosiban is indicated to delay imminent pre-term birth in pregnant adult women. Atosiban is useful in improving the pregnancy outcome of in vitro fertilization-embryo transfer (IVF-ET) in patients with repeated implantation failure (RIF). The pregnancy rate improved from zero to 43.7%.

    Inquiry
  • Buserelin Acetate

    Buserelin Acetate is an agonist of gonadotropin-releasing hormone receptor(GnRHR). Buserelin is a synthetic luteinizing hormone–releasing hormone (LHRH) analog.

    Inquiry
  • Angiotensin II

    Angiotensin II human (Angiotensin II) is a vasoconstrictor that mainly acts on the AT1 receptor. Angiotensin II human stimulates sympathetic nervous stimulation, increases aldosterone biosynthesis and renal actions. Angiotensin II human induces growth of vascular smooth muscle cells, increases collagen type I and III synthesis in fibroblasts, leading to thickening of the vascular wall and myocardium, and fibrosis. Angiotensin II human also induces apoptosis.

    Inquiry
  • Terlipressin Acetate

    Terlipressin acetate is a vasopressin analogue with potent vasoactive properties. Terlipressin acetate is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin acetate exerts anti-inflammatory and anti-oxidative effects. Terlipressin acetate has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research.

    Inquiry
  • Angiotensin II Acetate

    Angiotensin II is an octapeptide that produced from angiotensin I after the removal of two amino acids at the C-terminal by angiotensin-converting enzyme (ACE). Angiotensin II is mediated by AT1 and AT2 receptors, which are seven transmembrane glycoproteins with 30% sequence similarity.

    Inquiry
  • Deslorelin Acetate

    Deslorelin acetate is an injectable gonadotropin releasing hormone super-agonist (GnRH agonist) also known as an LHRH agonist. It stops the production of sex hormones (testosterone and oestrogen).

    Inquiry
Get in touch with us

USA

Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA

Tel: 1-631-624-4882

Fax: 1-631-614-7828

Email: info@creative-peptides.com

 

Germany

Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main

Email: info@creative-peptides.com

Copyright © 2025 Creative Peptides. All rights reserved.