Pancreatic Polypeptide (rana temporaria)

Pancreatic Polypeptide (rana temporaria) represents an amphibian-derived peptide exhibiting conserved tertiary motifs. Sequence variation enables evolutionary comparison with mammalian homologs. Structural dynamics support receptor-affinity modeling. Research employs it for peptide-folding analysis, biosynthetic mapping, and bioactive sequence characterization.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: P02024

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C192H276N52O58
M.W/Mr.
4240.62
Sequence
APSEPHHPGDQATQDQLAQYYSDLYQYITFVTRPRF-NH2
Length
36

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Epitope Mapping ServicesPeptide Nucleic Acids SynthesisCustom Conjugation ServicePeptide CDMOPeptide Modification ServicescGMP Peptide ServicePeptide Analysis ServicesPeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers