CAT# | P02024 |
M.F/Formula | C192H276N52O58 |
M.W/Mr. | 4240.62 |
Sequence | APSEPHHPGDQATQDQLAQYYSDLYQYITFVTRPRF-NH2 |
Length | 36 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
P02004 | Pancreatic Polypeptide (31-36), amide, human | Inquiry | ||
P02021 | Pancreatic Polypeptide (30-53), human | Inquiry | ||
P02011 | BDC2.5 Mimotope | Inquiry | ||
P02013 | Chromostatin, bovine | Inquiry | ||
P02009 | Apolipoprotein J (215-222) | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Margatoxin (MgTX) is a 39 amino acid peptide with significant sequence homology to charybdotoxin (ChTX), and ha ...
Ecallantide, sold under the trade name Kalbitor, is a plasma kallikrein inhibitor, consisting of sixty amino aci ...
of skin aging Skin aging is the obvious external manifestation of a natural process occurring in tissues and or ...
Aprotinin is a natural proteinase inhibitor polypeptide derived from bovine lung tissue. It is a monomeric glo ...
Secretin belongs to the vasoactive intestinal peptide/pituitary adenylate cyclase activating peptide family an ...