Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
M.W/Mr. | 2995.4 |
Sequence | HADGVFTSDFSRLLGQLSAKKYLESLI-NH2 |
Length | 27 |
1. Myotropic activity of allatostatins in tenebrionid beetles
5. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
Required fields are marked with *
×Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.